BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0026 (337 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0292 - 17358129-17358213,17358462-17358541,17358627-173587... 28 2.2 12_01_1092 - 11362094-11362367,11362739-11362795,11363256-113636... 26 8.7 >02_03_0292 - 17358129-17358213,17358462-17358541,17358627-17358797, 17359440-17359541,17360216-17360365,17360549-17360671, 17360781-17360867,17361209-17361289,17362071-17362210, 17363490-17363534,17365315-17365485,17365784-17365805 Length = 418 Score = 27.9 bits (59), Expect = 2.2 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +2 Query: 2 AAEGSENVPLFVDLSGVSIDKDKENSKVLISSGY---SKTKHGRSL 130 AA+ S + PL + G SID + E +K+L+S G S + HG L Sbjct: 60 AADDSGDTPLAYAVRGRSIDGECEIAKILLSRGAHVDSFSSHGTPL 105 >12_01_1092 - 11362094-11362367,11362739-11362795,11363256-11363683, 11364350-11365462 Length = 623 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -1 Query: 274 ILYNCHHLCIKLYLINKISIAIFNLVILLLKLFTKFEHLIILRK 143 +L NC L I+ + I I + + + + TK+ H +I+R+ Sbjct: 499 LLINCETLEIQADYTRYLDITIISTITVKMHSSTKYMHSLIVRR 542 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,310,796 Number of Sequences: 37544 Number of extensions: 63439 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 471517020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -