BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0026
(337 letters)
Database: arabidopsis
28,952 sequences; 12,070,560 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
At1g19090.1 68414.m02375 serine/threonine protein kinase (RKF2) ... 29 0.58
>At1g19090.1 68414.m02375 serine/threonine protein kinase (RKF2)
nearly identical to receptor-like serine/threonine
kinase GI:2465925 from [Arabidopsis thaliana]; intron 3
was added to circumvent a frameshift. Either a
sequencing error exists or this may be a pseudogene.
Length = 600
Score = 29.5 bits (63), Expect = 0.58
Identities = 15/40 (37%), Positives = 23/40 (57%)
Frame = +3
Query: 114 NTADH*DDTDLRSMIRCSNFVNSFNNSITKLKIAMLILLI 233
+ A+H D D R+ IR S F + + +T+L IA + L I
Sbjct: 240 DAAEHKPDADQRNFIRSSFFPHLSDRDVTRLAIAAISLSI 279
Database: arabidopsis
Posted date: Oct 4, 2007 10:56 AM
Number of letters in database: 12,070,560
Number of sequences in database: 28,952
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,605,536
Number of Sequences: 28952
Number of extensions: 58790
Number of successful extensions: 102
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 102
length of database: 12,070,560
effective HSP length: 72
effective length of database: 9,986,016
effective search space used: 389454624
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -