BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0023 (600 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1281.04 |||pyridoxal reductase |Schizosaccharomyces pombe|ch... 27 1.6 SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2... 27 2.8 SPAC589.11 |mug82||translation release factor |Schizosaccharomyc... 27 2.8 >SPCC1281.04 |||pyridoxal reductase |Schizosaccharomyces pombe|chr 3|||Manual Length = 333 Score = 27.5 bits (58), Expect = 1.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 86 VNKFG*FITCTIL*VSMVRLLPYFHGQLYNIIKTSYTLSRMV 211 + K G TCT L + ++ P+ HG L +KT+ L + Sbjct: 183 IEKNGILDTCTQLSIPIIAYAPFCHGLLTGRVKTAEDLKDFI 224 >SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 26.6 bits (56), Expect = 2.8 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +1 Query: 148 TLFPWTTIQYN*NFLYS*QDGDIHNVVRGLIKF*YQVGYHNKTVTTFSV 294 T+ P TT +F+ + + IH + G + GY N +VT+ +V Sbjct: 144 TVVPPTTHANTTSFVPTTTESSIHPITTGFYNTTFTTGYFNTSVTSVAV 192 >SPAC589.11 |mug82||translation release factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 182 Score = 26.6 bits (56), Expect = 2.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 Query: 142 SNHAHLEYGASNKLSKLINFSVETFYTKLLP 50 S H ++E A NK+S L+N S ET Y P Sbjct: 116 SQHKNIE-DALNKISDLLNKSAETLYVPDTP 145 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,241,662 Number of Sequences: 5004 Number of extensions: 40848 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -