BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0023 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 24 4.3 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 5.7 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 23.8 bits (49), Expect = 4.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 294 NRKSCHCFIVISHLVLKF 241 N+ +CHC +SH +L F Sbjct: 29 NKTNCHCARNLSHSLLSF 46 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.4 bits (48), Expect = 5.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 382 TINFKVPKLKPNMNLAMIMFYNHIKIHLMKQK 287 TI+F +P+L N+NL M+ + I + KQK Sbjct: 337 TIHFALPELLHNLNL-MVEYCEQDIITIDKQK 367 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 539,727 Number of Sequences: 2352 Number of extensions: 9681 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -