BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0023 (600 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83218-4|CAB05690.2| 706|Caenorhabditis elegans Hypothetical pr... 27 7.7 AF022983-1|AAB69946.2| 324|Caenorhabditis elegans Serpentine re... 27 7.7 >Z83218-4|CAB05690.2| 706|Caenorhabditis elegans Hypothetical protein C31A11.7 protein. Length = 706 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 67 KKSQLKS**VWIIYYLHHTL 126 K SQ+KS WII+Y+H L Sbjct: 339 KSSQIKSPLTWIIFYMHRYL 358 >AF022983-1|AAB69946.2| 324|Caenorhabditis elegans Serpentine receptor, class ab (class a-like) protein 16 protein. Length = 324 Score = 27.5 bits (58), Expect = 7.7 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 330 IMARFIFGFNFGTLKFIVT*NK-NSQE*QETLFYNIEKNN*TKKSVLIFISCKVILYKIY 506 I++ FI F FG L I T + S E + Y IE+N + + F C + IY Sbjct: 190 ILSNFIAFFQFGKLMRINTKIRVGSSENNLSQKYQIEENLNVVRILRAFTKCDFVFILIY 249 Query: 507 F 509 F Sbjct: 250 F 250 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,093,644 Number of Sequences: 27780 Number of extensions: 218978 Number of successful extensions: 304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -