BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0021 (750 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 26 0.28 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 26 0.28 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 2.6 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.6 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 8.0 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -3 Query: 694 VMSSSQAVSYFEDISCLSRSFTKPLSVSP 608 ++ ++ A+S+ ISC+SRS + LS+ P Sbjct: 534 ILVANVAISFGYLISCVSRSVSMALSIGP 562 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -3 Query: 694 VMSSSQAVSYFEDISCLSRSFTKPLSVSP 608 ++ ++ A+S+ ISC+SRS + LS+ P Sbjct: 534 ILVANVAISFGYLISCVSRSVSMALSIGP 562 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 389 RHQRYAARISVYGEGSRRARR 451 +HQ Y A + V G RRA R Sbjct: 26 QHQHYGAAVQVPQGGRRRAAR 46 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 187 SPRSESMSHKETLAPCFNN-SSLYAKPMPEAAPV 89 SP+ +S + P +N SSL P P A+P+ Sbjct: 242 SPQMQSYRPTGNITPHGSNTSSLITTPSPSASPL 275 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 Query: 148 APCFNNSSLYAKPMPEAAPVINATFP 71 AP N S Y P P AP+ P Sbjct: 408 APIPNVSPHYVTPTPPEAPLFQNVLP 433 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,847 Number of Sequences: 336 Number of extensions: 3771 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -