BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0016 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 25 0.82 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 2.5 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 2.5 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 4.4 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 25.0 bits (52), Expect = 0.82 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 619 SRIXNGVVXTWIA*RRVYESSLNV 690 S NG+V TWIA R +SL + Sbjct: 793 SHTPNGIVKTWIAHDRYLPNSLRI 816 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 23.4 bits (48), Expect = 2.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -1 Query: 539 NSLHYKDYKRTALANXPASIEMRFXNLY 456 N Y K+ A+ PA +++RF NL+ Sbjct: 169 NGETYLRIKKHAVKFNPAKVKLRFENLF 196 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 380 EITPSASSSLNKVLKAQYTDSVWLRRKDWXS 472 EIT S+ S + K Y SVW DW S Sbjct: 335 EITSSSCSYMAHE-KLSYAFSVWRMEDDWNS 364 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 725 VIVYNIHLXTE*TFKLLS*TRRYAIHV 645 V+V N+H + T K+ +R IH+ Sbjct: 326 VVVLNVHFRSPQTHKMAPWVKRVFIHI 352 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -1 Query: 725 VIVYNIHLXTE*TFKLLS*TRRYAIHV 645 V+V N+H + T K+ +R IH+ Sbjct: 326 VVVLNVHFRSPQTHKMAPWVKRVFIHI 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,950 Number of Sequences: 438 Number of extensions: 2812 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -