BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0015 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 28 0.064 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.7 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 28.3 bits (60), Expect = 0.064 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 323 NVPCGTSGGVLIYFERIEVVNKQDPQSVLXMVRNFTXEYDRTXIFN 460 +VPCGTSG L + ++ V K+ P S T E ++ +FN Sbjct: 225 SVPCGTSGNPLEWTGQVTVRKKRKPYSKFQ-----TLELEKEFLFN 265 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.2 Identities = 14/51 (27%), Positives = 20/51 (39%) Frame = +2 Query: 215 GGALLPVTSQAGFHMMIPLLTSYKAIQTTLQTDEVKNVPCGTSGGVLIYFE 367 GG T++AGF + TTL D + VP G + F+ Sbjct: 784 GGTPGKYTAEAGFMSFYEICDFLHEDNTTLVWDNEQQVPFAYRGNQWVGFD 834 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 507 AWVWALXN*FSSWCTL 460 AW+W L +W TL Sbjct: 464 AWIWLLWLLSQTWITL 479 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 507 AWVWALXN*FSSWCTL 460 AW+W L +W TL Sbjct: 464 AWIWLLWLLSQTWITL 479 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 507 AWVWALXN*FSSWCTL 460 AW+W L +W TL Sbjct: 464 AWIWLLWLLSQTWITL 479 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 507 AWVWALXN*FSSWCTL 460 AW+W L +W TL Sbjct: 464 AWIWLLWLLSQTWITL 479 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,204 Number of Sequences: 336 Number of extensions: 3241 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -