BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0015 (700 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 24 1.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 3.7 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 21 8.5 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +2 Query: 218 GALLPVTSQAGFHMMIPLLTSYKAIQTTLQTDEVKNVPCGTSGGV 352 GAL + S G+ + PL+ + I T + +P G GG+ Sbjct: 301 GALAGLLSVLGYKYITPLIQKHLKIHDTCGVHNLHGMP-GILGGI 344 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 230 PVTSQAGFHMMIPLLTSYKAIQTTLQTDEVKNVPCGTS 343 P+ S F + P+ T+ Q+T+QT + P TS Sbjct: 385 PIGSGGSFPSLYPMATTSPQSQSTIQTLRPQVSPDRTS 422 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.4 bits (43), Expect = 8.5 Identities = 4/8 (50%), Positives = 6/8 (75%) Frame = -2 Query: 519 CIPRAWVW 496 C+P W+W Sbjct: 160 CVPAGWIW 167 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,640 Number of Sequences: 438 Number of extensions: 3346 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -