BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0010 (830 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.10 |||mitochondrial ribosomal protein subunit L35|Schiz... 28 1.9 SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa... 25 10.0 >SPBC2F12.10 |||mitochondrial ribosomal protein subunit L35|Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 27.9 bits (59), Expect = 1.9 Identities = 29/131 (22%), Positives = 60/131 (45%), Gaps = 10/131 (7%) Frame = -1 Query: 644 LPFNII*RYLKIIESFLQLPKWTVSK-------LLISISNKNVRRIDFDVNALIFI--K* 492 LPFN + +I L +P + ++ LL +I + +R+ D + F Sbjct: 226 LPFNCKKNHYSVITLDLDVPNYETNRFETHCNWLLTNIPIEASKRVPIDTSKAFFQYRPP 285 Query: 491 IYYLDSRRTFILDYLLQT*LFVLNLHHPANISIKEQYA*CEFLNVFDSVKVNSYLYAHG- 315 I + + IL +L+ +++ P+N ++E++ EF +++D V ++L+ G Sbjct: 286 IVHRGEDKHRILTLVLRQKSSSISI--PSNALVRERFDLSEFCSIYDLEPVGAHLWRSGW 343 Query: 314 TAPLAANVGKH 282 + A + KH Sbjct: 344 DSDAVALLSKH 354 >SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 25.4 bits (53), Expect = 10.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 165 GECFKGLIVLILIIFATFIFYQLHYLL 85 G C++GL+ LIL I + I Y L +LL Sbjct: 219 GRCWRGLLWLILFITGSSI-YPLKFLL 244 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,716,201 Number of Sequences: 5004 Number of extensions: 49353 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 408446760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -