BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0010
(830 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 23 8.6
>AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione
S-transferase D8 protein.
Length = 224
Score = 23.4 bits (48), Expect = 8.6
Identities = 17/52 (32%), Positives = 22/52 (42%)
Frame = +3
Query: 471 SRI*IVYLFDKY*CIDIKIYSSDVFVRNRY*QFRYXPFRQL*KALYDLQVPL 626
SR +VYL DKY + ++Y D R Q + L L D PL
Sbjct: 65 SRAILVYLVDKYGRTNSRLYPKDAKTRAIINQRLFFDHGTLGTRLEDYYYPL 116
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 658,509
Number of Sequences: 2352
Number of extensions: 11149
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 64
effective length of database: 413,451
effective search space used: 87651612
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -