Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0010
         (830 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g19180.1 68417.m02830 nucleoside phosphatase family protein /...    28   8.7  

>At4g19180.1 68417.m02830 nucleoside phosphatase family protein /
           GDA1/CD39 family protein low similarity to SP|O18956
           Ectonucleoside triphosphate diphosphohydrolase 1 (EC
           3.6.1.5) (Ecto-apyrase) {Bos taurus}; contains Pfam
           profile PF01150: GDA1/CD39 (nucleoside phosphatase)
           family
          Length = 740

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = +1

Query: 154 KTLSCKISLKF*DYTVLMRKDDICII--LLYSLLYALTRRTELQQCLPTFAARGAVP 318
           K LS  + LK  + T+ M+ + I +I  L+ SLL  L   + +  CLP F  +  +P
Sbjct: 564 KALSSTLGLKSYE-TLSMKINPIALISILILSLLLLLCALSRVSNCLPRFFRKSYLP 619


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,209,855
Number of Sequences: 28952
Number of extensions: 221833
Number of successful extensions: 401
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 396
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 401
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1911862400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)