BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0009 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.8 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.3 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 3.1 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 3.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.3 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.8 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +3 Query: 111 HVEDHAPAKYEFSYSVEDPHTGDHKSQHETRDGDVVKGEYSLLQPDGSIRKVEYTADHHN 290 H+ D P E Y T H+ ETR KG + +P GS+R + D+ N Sbjct: 166 HIRDVGP---EDGYKTYQCRT-KHRLTGETRLS-ATKGRLVITEPVGSVRPKFPSMDNIN 220 Query: 291 GFN 299 G + Sbjct: 221 GLS 223 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 450 VHSTPVVHSAPLIHSAPVVHSAPLVHSGPVVHTASLYHATP 572 V+STP H + H +H+ P H T H+TP Sbjct: 408 VYSTPGPHHHTMGHGHSHIHATPHHHHSHAA-TPHHQHSTP 447 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 108 DHVEDHAPAKYEFSYSVEDP 167 DH DHAP + E + V DP Sbjct: 340 DH-GDHAPKQTEVRFKVHDP 358 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 108 DHVEDHAPAKYEFSYSVEDP 167 DH DHAP + E + V DP Sbjct: 340 DH-GDHAPKQTEVRFKVHDP 358 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.3 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 577 YTQLLSCTPYTLHQHT 624 + ++SC+P T+H T Sbjct: 358 FCNIVSCSPQTVHPET 373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,462 Number of Sequences: 438 Number of extensions: 3346 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -