BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0006 (385 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces ... 28 0.58 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 24 7.1 SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizo... 24 7.1 SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 24 9.4 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 24 9.4 SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ... 24 9.4 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 24 9.4 >SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces pombe|chr 2|||Manual Length = 780 Score = 27.9 bits (59), Expect = 0.58 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 221 RCRHSSSKHHVVGMRTNPVSCLTHYTFFSHV 129 +CR S K+ + R P S L+HY SH+ Sbjct: 660 KCRWSDCKYEI--QRLTPASELSHYQLLSHI 688 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 24.2 bits (50), Expect = 7.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -2 Query: 231 YPRQVSPLIQQTSRSRDEDEPGLLSYSLYI 142 +P +V+P+I S + D PG +S+++ Sbjct: 176 HPPEVAPMIAIPSSRSNYDSPGWAHHSIFL 205 >SPAC26H5.07c |||seven transmembrane receptor-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 505 Score = 24.2 bits (50), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 166 SPVLLTIHFSAMFLWFYLCINRSL 95 +PV L F AMFLW L +N ++ Sbjct: 323 APVFLITLF-AMFLWIVLALNNTI 345 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 23.8 bits (49), Expect = 9.4 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -2 Query: 66 VSIVCSVGLRIGYYLYF 16 V ++C + + IGY+L+F Sbjct: 2373 VCLICQLSVIIGYFLFF 2389 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 23.8 bits (49), Expect = 9.4 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 381 FFFFLFYAQIRNKVARWQSNIIIVVR 304 FFF ++ +RN VA W+ + ++ R Sbjct: 1069 FFFQIYKISMRNFVAYWRDSSLLRAR 1094 >SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 615 Score = 23.8 bits (49), Expect = 9.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -1 Query: 175 RTRSPVLLTIHFSAMFLWFYLCINRSLPAMFFWFYLCI 62 R R L I F+ +FL +C R F +YLCI Sbjct: 558 RNRRNAKLLIAFTILFLVGLICGWRLNRFTMFIYYLCI 595 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 23.8 bits (49), Expect = 9.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 90 PCFFGFICVSIVCSVGLRIGYYLYFIP 10 PC F IC ++ ++G Y YF P Sbjct: 360 PCVFSIICTAVSANMG---PMYPYFYP 383 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,464,669 Number of Sequences: 5004 Number of extensions: 25635 Number of successful extensions: 78 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 126307516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -