BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0004 (750 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0E238 Cluster: Chromosome undetermined scaffold_74, wh... 34 4.3 UniRef50_Q0USG1 Cluster: Putative uncharacterized protein; n=1; ... 33 5.7 UniRef50_UPI0000F2C24B Cluster: PREDICTED: hypothetical protein;... 33 7.5 UniRef50_Q5ANN7 Cluster: Putative uncharacterized protein; n=2; ... 33 9.9 UniRef50_Q9UIL4 Cluster: Kinesin-like protein KIF25; n=2; Euther... 33 9.9 >UniRef50_A0E238 Cluster: Chromosome undetermined scaffold_74, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_74, whole genome shotgun sequence - Paramecium tetraurelia Length = 624 Score = 33.9 bits (74), Expect = 4.3 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 5/100 (5%) Frame = -2 Query: 689 TXSYVLXESAXPLRSFSNTANGIGVFDVSSIK-----SYTFNLNLTYSYELSNESPHQNP 525 T +Y S+ ++SN++N + S+ SY ++ NLTYSY+ + S + Sbjct: 95 TYNYTYQSSSTQYPTYSNSSNSSNSSNSSNTTNGSNGSYPYS-NLTYSYDYPSTSNSSSN 153 Query: 524 RLSWNRTHNNETI*KYCA*INYNNHN**RFAYRRCSLEKR 405 S+N T+ TI + NYN R+ R L R Sbjct: 154 SSSYNTTNQTSTINQTNGSSNYNRTINSRYIPSRLQLRVR 193 >UniRef50_Q0USG1 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1269 Score = 33.5 bits (73), Expect = 5.7 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +1 Query: 1 FYLXP---SEPKPT-SPARGAPCRSTNEALARRGRHGTTVAYIVDDSGSDHKFPTTTXL 165 FY P +P P+ P R P +STN A+ G G + + S ++ K TTT L Sbjct: 1147 FYTSPPTQKDPSPSPEPVRNGPPQSTNSIFAQPGMKGKKIKIVSAQSKANGKTTTTTTL 1205 >UniRef50_UPI0000F2C24B Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 466 Score = 33.1 bits (72), Expect = 7.5 Identities = 20/54 (37%), Positives = 33/54 (61%) Frame = +3 Query: 282 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRSLVSTFLQRTPAIRESL 443 LL ++G D L+V++CV+ KY ++TL +LG+ R + +QR A R +L Sbjct: 374 LLQDSIGGDAKLLVLLCVSPCQKYLAETLQSLGFGSR---ARQVQRVQAKRRNL 424 >UniRef50_Q5ANN7 Cluster: Putative uncharacterized protein; n=2; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 172 Score = 32.7 bits (71), Expect = 9.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -2 Query: 623 IGVFDVSSIKSYTFNLNLTYSYELSNESPHQNPRLSWNRTHNNETI 486 +G+ + I S LN Y +S+ P N SWN HNN +I Sbjct: 11 LGIEEPIDISSKNVPLNAFLIYTMSSTLPDHNSTNSWNEYHNNLSI 56 >UniRef50_Q9UIL4 Cluster: Kinesin-like protein KIF25; n=2; Eutheria|Rep: Kinesin-like protein KIF25 - Homo sapiens (Human) Length = 384 Score = 32.7 bits (71), Expect = 9.9 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +3 Query: 282 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRSLVSTFLQRTPA 428 LL LG D L+VI+C++ S ++ + TL LG+ +R + +QR PA Sbjct: 323 LLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIR---ARQVQRGPA 368 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,120,873 Number of Sequences: 1657284 Number of extensions: 11411032 Number of successful extensions: 26097 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26069 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61734884250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -