SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1750
         (725 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          23   2.9  
DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex det...    21   9.0  
DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex det...    21   9.0  
AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cycl...    21   9.0  

>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 9/37 (24%), Positives = 17/37 (45%)
 Frame = +1

Query: 25  PPGALVVTW*SRFIHSPSHSKNDMYT*DQIDLEYDPL 135
           PP A +V      +  P H   D+   D + ++++ L
Sbjct: 300 PPSATLVGTTITHLRDPDHHSTDIQNCDSVKIKFETL 336


>DQ325124-1|ABD14138.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +1

Query: 265 RQMFCSMYKFLYY 303
           ++++C+ YK LYY
Sbjct: 97  KKLYCNNYKKLYY 109


>DQ325123-1|ABD14137.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/13 (46%), Positives = 11/13 (84%)
 Frame = +1

Query: 265 RQMFCSMYKFLYY 303
           ++++C+ YK LYY
Sbjct: 97  KKLYCNNYKKLYY 109


>AB204559-1|BAD89804.1|  832|Apis mellifera soluble guanylyl cyclase
           beta-3 protein.
          Length = 832

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%)
 Frame = +3

Query: 624 IHIFFIATH*DRQSTEESVGRADGERHL-LGA 716
           +H+ F  T  +R  T+ S+     E+HL +GA
Sbjct: 174 VHVTFKLTFDNRAFTQASLAMTREEKHLPIGA 205


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 207,506
Number of Sequences: 438
Number of extensions: 4956
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -