BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= br--1726
(673 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 23 6.6
>AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin
receptor protein.
Length = 450
Score = 23.4 bits (48), Expect = 6.6
Identities = 15/64 (23%), Positives = 29/64 (45%)
Frame = +1
Query: 217 KKKFKITSLPKYIVNYYSLKFLLLQIKFVLLQKNMLVNKKEYLFKIINKLIT*FDSYEHY 396
K K ++ + +V +++ +L QI F+L + KK Y+ ++ + S Y
Sbjct: 290 KSKRRVVKMMMIVVIIFAVCWLPFQIYFILTSYYPELTKKPYIQEVYLAIYWLAMSNSMY 349
Query: 397 NKFI 408
N I
Sbjct: 350 NPII 353
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 649,600
Number of Sequences: 2352
Number of extensions: 12406
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -