BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1708X (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0210 - 15874289-15875663,15878248-15879263 27 6.1 02_04_0546 - 23782400-23782599,23782744-23782830,23782923-237834... 27 6.1 01_06_0102 - 26447286-26448107,26448248-26448385,26448990-264493... 27 8.1 >10_08_0210 - 15874289-15875663,15878248-15879263 Length = 796 Score = 27.1 bits (57), Expect = 6.1 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 264 NLCQYRTLTLVLYYIDYKLQE**IKYEYYNLPIR*QTLQYLKRLFIYKSL-IITAANLRR 88 ++ +T L L + YKL ++ ++NLPI LQ +RL +Y L AAN +R Sbjct: 265 DILDQKTKDLCLSFALYKL----LRRRFFNLPIHEARLQKTRRLVVYGILGEGDAANYKR 320 >02_04_0546 - 23782400-23782599,23782744-23782830,23782923-23783442, 23783801-23784000,23784457-23784561,23784923-23785020, 23785168-23785271 Length = 437 Score = 27.1 bits (57), Expect = 6.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 215 INYRNDKLNMNTITYLYVNKLYNI*NDYLFT 123 I Y ND LN +++ YL N N +DY+FT Sbjct: 264 IVYAND-LNPDSVRYLRTNAQINKVDDYIFT 293 >01_06_0102 - 26447286-26448107,26448248-26448385,26448990-26449359, 26449505-26449606,26449696-26449788,26449934-26450181, 26451088-26451274,26451825-26452043,26452464-26452660, 26453545-26453875,26454099-26454457,26455141-26455240, 26455349-26455464,26455547-26455663,26455782-26455880, 26456057-26456131,26456205-26456286,26457724-26457763, 26458685-26458769,26458924-26459055 Length = 1303 Score = 26.6 bits (56), Expect = 8.1 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -3 Query: 294 LLSYSDLYNFNLCQYRTLTLVLYY 223 +L+ + L++ N+C Y+TLT + Y+ Sbjct: 1021 MLAEAVLHSQNVCDYQTLTRIFYF 1044 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,911,567 Number of Sequences: 37544 Number of extensions: 115236 Number of successful extensions: 162 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -