BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1708X (419 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 2.6 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 4.5 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 4.5 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 22 7.9 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 22 7.9 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.8 bits (49), Expect = 2.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 141 KRLFIYKSLIITAANLRRYHIRYNY 67 KRL + + I+ A +RRY + +NY Sbjct: 472 KRLAMMEMEIVIARLVRRYEVGWNY 496 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 4.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 288 SYSDLYNFNLCQYRTLTLVLYYIDY 214 S S YNF L YR L +L D+ Sbjct: 272 SLSVRYNFRLTDYRKLNSILSRADW 296 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 4.5 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = -3 Query: 141 KRLFIYKSLIITAANLRRYHIRYNY 67 +RL + + +ITA +R++ +R+NY Sbjct: 472 RRLAMMELEMITARLVRQFELRWNY 496 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 22.2 bits (45), Expect = 7.9 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 189 YEYYNLPIR*QTLQYLKRLFIYKSLIITAANL-RRYHIRYNY 67 + Y +LP + R F L I + L RRY + YNY Sbjct: 44 HPYVSLPFGYGRRTCIGRRFAECELQILLSKLFRRYQVEYNY 85 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 22.2 bits (45), Expect = 7.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 141 KRLFIYKSLIITAANLRRYHIRYNY 67 KRL + + +I A +R++ R+NY Sbjct: 465 KRLAMMEMEVILARWIRQFEFRWNY 489 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 362,782 Number of Sequences: 2352 Number of extensions: 6032 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -