BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1707 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 25 3.3 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 25 3.3 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 25 3.3 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 25 3.3 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 24 5.8 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 393 HIYEMCQKMYFLLVLNKNKSLNADKQTKVPMTLI*HITLLQNDIQVKNTCVRESD-SLIL 569 H+Y + Q +YF V + N NA +TLI + +I C+R+ + +L Sbjct: 24 HLYALTQALYFKDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYH 83 Query: 570 PK 575 PK Sbjct: 84 PK 85 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 393 HIYEMCQKMYFLLVLNKNKSLNADKQTKVPMTLI*HITLLQNDIQVKNTCVRESD-SLIL 569 H+Y + Q +YF V + N NA +TLI + +I C+R+ + +L Sbjct: 24 HLYALTQALYFKDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYH 83 Query: 570 PK 575 PK Sbjct: 84 PK 85 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 393 HIYEMCQKMYFLLVLNKNKSLNADKQTKVPMTLI*HITLLQNDIQVKNTCVRESD-SLIL 569 H+Y + Q +YF V + N NA +TLI + +I C+R+ + +L Sbjct: 24 HLYALTQALYFKDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYH 83 Query: 570 PK 575 PK Sbjct: 84 PK 85 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 24.6 bits (51), Expect = 3.3 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Frame = +3 Query: 393 HIYEMCQKMYFLLVLNKNKSLNADKQTKVPMTLI*HITLLQNDIQVKNTCVRESD-SLIL 569 H+Y + Q +YF V + N NA +TLI + +I C+R+ + +L Sbjct: 58 HLYALTQALYFKDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYH 117 Query: 570 PK 575 PK Sbjct: 118 PK 119 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 142 KRLFIYKSLIITATNLRRYHIRYNY 68 KRL + + I+ A +RRY + +NY Sbjct: 472 KRLAMMEMEIVIARLVRRYEVGWNY 496 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 644,468 Number of Sequences: 2352 Number of extensions: 11792 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -