BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1707 (753 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g24450.1 68417.m03505 starch excess protein-related similar t... 30 1.4 At3g22104.1 68416.m02789 phototropic-responsive NPH3 protein-rel... 29 4.4 >At4g24450.1 68417.m03505 starch excess protein-related similar to SEX1 [Arabidopsis thaliana] GI:12044358 Length = 1284 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 146 FKTTIYLQVINYNSNEPPQVSYTI 75 FKTTI ++I+ N N PP++ Y I Sbjct: 684 FKTTIEKRLISLNFNNPPEIIYVI 707 >At3g22104.1 68416.m02789 phototropic-responsive NPH3 protein-related contains BTB/POZ domain, INTERPRO:IPR000210 Length = 506 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -3 Query: 751 MKVFFKIKIKRKYSNIIILTFPFLYKLFKVK*DKL*YCASPKH 623 +++F K+ + RK+ N+II F F Y+ KVK +C++ H Sbjct: 201 VEMFLKLMVLRKFDNLIISRFLFYYQ--KVK-----FCSASSH 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,645,394 Number of Sequences: 28952 Number of extensions: 223292 Number of successful extensions: 336 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -