BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1705 (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 25 0.53 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.6 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 25.0 bits (52), Expect = 0.53 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 215 GLSAYHSSD*SSLHYGNCYLLGPTERLGTFQLGSLEKR 328 G ++ +D S +H+ LLG E T LGS+ R Sbjct: 122 GATSQPPTDNSHVHHHQTSLLGKVEGAATHHLGSVYSR 159 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 183 NSYSDANRHHNQSDP 139 ++YS A+RHH P Sbjct: 151 SAYSSASRHHVDHQP 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,009 Number of Sequences: 336 Number of extensions: 3797 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -