BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1704 (657 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1173 + 11092482-11093465,11093552-11093914 29 2.5 10_01_0133 + 1621574-1625779 28 7.5 >07_01_1173 + 11092482-11093465,11093552-11093914 Length = 448 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 463 KPTHFFIFCCPCLKLLYFSGDLFQIKSPQ--KC 555 KP F+ C PCL+ LY + +F+ +S + KC Sbjct: 310 KPVVDFLRCFPCLEALYITSHMFEPRSMETLKC 342 >10_01_0133 + 1621574-1625779 Length = 1401 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/65 (30%), Positives = 31/65 (47%) Frame = +1 Query: 442 NNWKRCSKPTHFFIFCCPCLKLLYFSGDLFQIKSPQKCFLNPTSYSA*MVKIIYWTLGTS 621 N W S+ + CP LK L FS DL +++P + ++++I W TS Sbjct: 942 NTWHLFSQLEQVKVSNCPVLKELPFSHDLKLLQTPDAQERHIFRPDLQILRVIGWR--TS 999 Query: 622 LAAPV 636 A+PV Sbjct: 1000 QASPV 1004 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,037,111 Number of Sequences: 37544 Number of extensions: 240804 Number of successful extensions: 287 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 287 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -