BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1701 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59538| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-05) 31 0.91 SB_29796| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) 29 2.8 SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 29 4.9 SB_29302| Best HMM Match : LRR_1 (HMM E-Value=1.1e-11) 28 6.4 SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 >SB_59538| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-05) Length = 191 Score = 31.1 bits (67), Expect = 0.91 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 134 YKHLFLPLKNKKRCKYIKNSNAFCYCFKELYSLPAF 27 Y H+ +P KN + K AFC+ F L ++P F Sbjct: 2 YFHICVPFKNIITTSFTKKMAAFCWIFSLLLTIPNF 37 >SB_29796| Best HMM Match : 7tm_1 (HMM E-Value=1.6e-08) Length = 362 Score = 29.5 bits (63), Expect = 2.8 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = -3 Query: 205 YVVKITILLLFDINKNITLILNKHTSISFYRSKIKRDASI*KIQTRSVIALKSCIRY--- 35 Y++ ITI+ + I+ + +IL K SI RSK+ + ++ S+ L I Y Sbjct: 128 YIIAITIIWVLAISIELPVILYKLNSIQMGRSKLNALENYLRVVFVSLAILTMAICYLAI 187 Query: 34 ---RRFVQP 17 RRF QP Sbjct: 188 LLKRRFSQP 196 >SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 896 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -2 Query: 161 KHYFNFKQTYKHLFLPLKNK-KRCKYIKNSNAFCYCFKELYSLPAFCS 21 KH + K + P+K + KYI N YC+ + S+ A CS Sbjct: 403 KHCVKLPRCGKLFYNPMKYRCAHNKYIYNPKTHKYCYGRIISISAHCS 450 >SB_29302| Best HMM Match : LRR_1 (HMM E-Value=1.1e-11) Length = 606 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 688 INFSSKLMYKIASHWLGRYFFLCSSLT 608 +NF+ KL +++ S W FF C +T Sbjct: 482 VNFNVKLYFRLNSGWCKALFFCCGVIT 508 >SB_30503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 131 KHLFLPLKNK-KRCKYIKNSNAFCYCFKELYSLPAFCS 21 K + P+K + R KYI N YC+ + S+ A CS Sbjct: 1342 KIFYNPIKYRCARNKYIYNPKTHKYCYGRIISISAHCS 1379 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,226,415 Number of Sequences: 59808 Number of extensions: 325757 Number of successful extensions: 586 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -