BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1700X (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0109 + 6830802-6833412,6833491-6833861 28 3.0 07_03_0297 - 16383159-16383626 27 5.3 04_01_0109 + 1120981-1121249,1121326-1121536,1121683-1121880 27 5.3 03_01_0051 + 445035-445303,445380-445590,445737-445930,446151-44... 27 5.3 11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238,792... 27 7.0 11_02_0062 - 7909343-7909413,7909509-7910974,7911064-7912088,791... 27 7.0 06_02_0178 + 12652654-12652877,12652964-12653140,12653141-126532... 27 9.2 >02_02_0109 + 6830802-6833412,6833491-6833861 Length = 993 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 290 SYKREVKERSVTRQTILK-KKH*RSS*TVKRW*TITTGHC 174 SY + + + Q +L+ K H SS + RW + TT HC Sbjct: 23 SYPKSTNQSNEEHQILLELKNHWGSSPALGRWNSTTTAHC 62 >07_03_0297 - 16383159-16383626 Length = 155 Score = 27.5 bits (58), Expect = 5.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 33 FEFFIYLHLFLFLSGRKRCLYVCLKLK 113 F+F +LHL L + G L +CL+ K Sbjct: 7 FDFVFHLHLMLMILGYANALSLCLQRK 33 >04_01_0109 + 1120981-1121249,1121326-1121536,1121683-1121880 Length = 225 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 97 TYKHLFLPLKNKKRCKYIKNSNAFCYCFKEL 5 ++KHL L N + +K FC C+KEL Sbjct: 88 SWKHLALGWANVEPDTPVKAGTRFCICYKEL 118 >03_01_0051 + 445035-445303,445380-445590,445737-445930,446151-446228, 447049-447141,448495-448525,448729-449058 Length = 401 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 97 TYKHLFLPLKNKKRCKYIKNSNAFCYCFKEL 5 ++KHL L N + +K FC C+KEL Sbjct: 88 SWKHLALGWANVEPDTPVKAGTRFCICYKEL 118 >11_02_0063 + 7916048-7917135,7917225-7918690,7920177-7920238, 7921808-7922407 Length = 1071 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 12 LKQ*QNAFEFFIYLHLFLFLSGRKRCLYVCLKLK 113 LKQ +FEF + +HL + L G+ L CL+ K Sbjct: 560 LKQ-MESFEFVLIMHLMIRLLGKTNDLSQCLQKK 592 >11_02_0062 - 7909343-7909413,7909509-7910974,7911064-7912088, 7912300-7912809,7913418-7913441,7913617-7913673 Length = 1050 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 12 LKQ*QNAFEFFIYLHLFLFLSGRKRCLYVCLKLK 113 LKQ +FEF + +HL + L G+ L CL+ K Sbjct: 736 LKQ-MESFEFVLIMHLMIRLLGKTNDLSQCLQKK 768 >06_02_0178 + 12652654-12652877,12652964-12653140,12653141-12653214, 12653424-12653530,12653637-12653792,12653933-12654019, 12654247-12654344,12654467-12654554,12654810-12654911 Length = 370 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +2 Query: 38 IFYILASLFIFER*KEMLVCLFKIKVMFLLMSNNNKI 148 +F +LASLF+F +V F++ M + +++ +K+ Sbjct: 58 VFLVLASLFLFPLRVAAMVVAFQLLFMLIPLNDKDKL 94 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,625,573 Number of Sequences: 37544 Number of extensions: 155104 Number of successful extensions: 315 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -