BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1700X (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067608-15|AAO38679.1| 470|Caenorhabditis elegans Hypothetical... 30 0.89 U41107-2|AAK73880.1| 111|Caenorhabditis elegans Temporarily ass... 27 8.3 >AF067608-15|AAO38679.1| 470|Caenorhabditis elegans Hypothetical protein B0511.14b protein. Length = 470 Score = 29.9 bits (64), Expect = 0.89 Identities = 18/71 (25%), Positives = 33/71 (46%) Frame = -2 Query: 220 ARKRSNAGRRSQQATASEIRGQNYYFIIIRH**KHYFNFKQTYKHLFLPLKNKKRCKYIK 41 +R+RS+ G +++ + G F H+F K K F+ L+ KK+ K+ + Sbjct: 383 SRRRSSTGATNRKRKYTRRAGSPAVFAGNLMKKVHFFGLKYLQKLTFMSLEIKKKTKFYQ 442 Query: 40 NSNAFCYCFKE 8 + F C +E Sbjct: 443 SHLLFRCCIRE 453 >U41107-2|AAK73880.1| 111|Caenorhabditis elegans Temporarily assigned gene nameprotein 234 protein. Length = 111 Score = 26.6 bits (56), Expect = 8.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 361 VIFVYEKLPLHTYCTRNSQTGNFSN 435 V FV E P YC + QTG+++N Sbjct: 35 VPFVSEPCPFSKYCMKIFQTGSYNN 59 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,324,264 Number of Sequences: 27780 Number of extensions: 168872 Number of successful extensions: 384 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -