BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1699 (767 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; ... 65 2e-09 UniRef50_A7SZ23 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.6 >UniRef50_Q86QT5 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 77 Score = 64.9 bits (151), Expect = 2e-09 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 8/70 (11%) Frame = -2 Query: 310 HPNCNFCKFNFYYMTS*PGDFVAPQSINKRPKLLYKIN-KRNPSV-------GGHQNCYF 155 +P+ + F + + P DFV PQSINKRPK LYKIN K+ + QNCYF Sbjct: 8 YPHTELSQILFMIILADPADFVVPQSINKRPKHLYKINLKQTKGIRQTGDTSKEKQNCYF 67 Query: 154 YLIPKIFIFI 125 YLIP+IFIFI Sbjct: 68 YLIPRIFIFI 77 >UniRef50_A7SZ23 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 121 Score = 34.7 bits (76), Expect = 2.6 Identities = 20/52 (38%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -3 Query: 615 KPAKV-GPYCLYL*QSRHAFHFEGWNNSYVFLYFYCLMGGRAHGPLDAKCLP 463 KP+ V G YC+ R FEGW ++ CL GG GP CLP Sbjct: 58 KPSCVNGGYCVGSNTCRCLRGFEGWRCEHMKCMVSCLNGGSCVGPYLCNCLP 109 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,416,728 Number of Sequences: 1657284 Number of extensions: 17504936 Number of successful extensions: 33777 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33771 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 64204279620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -