BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1699 (767 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC051675-1|AAH51675.1| 515|Homo sapiens gap junction protein, a... 26 3.5 AL139260-3|CAI23051.1| 515|Homo sapiens gap junction protein, a... 26 3.5 AF271261-1|AAK55516.1| 515|Homo sapiens connexin 58 protein. 26 3.5 AF179597-1|AAG09406.1| 515|Homo sapiens connexin 59 protein. 26 3.5 DQ926045-1|ABI50710.1| 126|Homo sapiens immunoglobulin heavy ch... 31 4.5 >BC051675-1|AAH51675.1| 515|Homo sapiens gap junction protein, alpha 10, 59kDa protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 591 NMDQPLQAYFMPPVNADWLSQYADTIFGESS 683 NM Q Q F P N DW ++ +G S+ Sbjct: 400 NMRQSPQTVFSLPANCDWKPRWLRATWGSST 430 Score = 24.2 bits (50), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 501 HPSSNKNKETHNCCSIPQNGTRV 569 H SSN NK+TH NG ++ Sbjct: 345 HISSNNNKDTHKIFGKELNGNQL 367 >AL139260-3|CAI23051.1| 515|Homo sapiens gap junction protein, alpha 10, 59kDa protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 591 NMDQPLQAYFMPPVNADWLSQYADTIFGESS 683 NM Q Q F P N DW ++ +G S+ Sbjct: 400 NMRQSPQTVFSLPANCDWKPRWLRATWGSST 430 Score = 24.2 bits (50), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 501 HPSSNKNKETHNCCSIPQNGTRV 569 H SSN NK+TH NG ++ Sbjct: 345 HISSNNNKDTHKIFGKELNGNQL 367 >AF271261-1|AAK55516.1| 515|Homo sapiens connexin 58 protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 591 NMDQPLQAYFMPPVNADWLSQYADTIFGESS 683 NM Q Q F P N DW ++ +G S+ Sbjct: 400 NMRQSPQTVFSLPANCDWKPRWLRATWGSST 430 Score = 24.2 bits (50), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 501 HPSSNKNKETHNCCSIPQNGTRV 569 H SSN NK+TH NG ++ Sbjct: 345 HISSNNNKDTHKIFGKELNGNQL 367 >AF179597-1|AAG09406.1| 515|Homo sapiens connexin 59 protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 3.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 591 NMDQPLQAYFMPPVNADWLSQYADTIFGESS 683 NM Q Q F P N DW ++ +G S+ Sbjct: 400 NMRQSPQTVFSLPANCDWKPRWLRATWGSST 430 Score = 24.2 bits (50), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 501 HPSSNKNKETHNCCSIPQNGTRV 569 H SSN NK+TH NG ++ Sbjct: 345 HISSNNNKDTHKIFGKELNGNQL 367 >DQ926045-1|ABI50710.1| 126|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 126 Score = 31.1 bits (67), Expect = 4.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 412 NSNSQFLQYNSCPAL*TETHYCFTAEICRFHSAYHPNCNF 293 + N+ +LQ NS T +YC + F SAYH C++ Sbjct: 75 SKNTLYLQMNSLRVEDTAIYYCAIGVVGDFWSAYHGACDY 114 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,626,058 Number of Sequences: 237096 Number of extensions: 2688759 Number of successful extensions: 12725 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12725 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9255747988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -