BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1693X (437 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces pom... 25 6.7 SPBC16G5.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 6.7 SPAC20H4.07 |rhp57||RecA family ATPase Rhp57|Schizosaccharomyces... 25 6.7 SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual 24 8.9 SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce... 24 8.9 SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptid... 24 8.9 >SPAC23D3.06c |nup146||nucleoporin Nup146|Schizosaccharomyces pombe|chr 1|||Manual Length = 1325 Score = 24.6 bits (51), Expect = 6.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 279 RITPSLIHEISVTVLLPPTPRE 344 R TP IHE+ V +L P+E Sbjct: 944 RSTPPKIHEVGVNKMLDVVPKE 965 >SPBC16G5.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 126 Score = 24.6 bits (51), Expect = 6.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 343 KYI*RFRRFAAQEDSVRSDGSRRICQCRI 429 +YI ++ F A+E+ + +R +C C I Sbjct: 38 RYIRKYENFFAKENENLNTAARLVCDCPI 66 >SPAC20H4.07 |rhp57||RecA family ATPase Rhp57|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 24.6 bits (51), Expect = 6.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 275 RTHHAKSHSRDLGNSPLTANATGNTSRDLEDSPHK 379 R + +KSH RDL N N G + L H+ Sbjct: 217 RYNRSKSHFRDLDNIAKRGNQLGKLAMTLRTLAHQ 251 >SPCC18.13 |||tRNA |Schizosaccharomyces pombe|chr 3|||Manual Length = 421 Score = 24.2 bits (50), Expect = 8.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 323 EDCYRDLVNETWRDA 279 E CYRD +NE R+A Sbjct: 44 EHCYRDNINEKHREA 58 >SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 24.2 bits (50), Expect = 8.9 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 Query: 154 PPRTSPWLPMTRSSGQGYNLHLP 222 PP PW P++ Q + + LP Sbjct: 312 PPTAEPWEPISAPKKQEFGVSLP 334 >SPCC553.04 |cyp9||WD repeat containing cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp9|Schizosaccharomyces pombe|chr 3|||Manual Length = 610 Score = 24.2 bits (50), Expect = 8.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 429 YTALAYSPGAIRPDRIFLCGESSKSLDVFPV 337 + A+ S + +R+F+ G KSL VF V Sbjct: 89 HNAMLLSAELSQDERLFITGADDKSLKVFDV 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,614,867 Number of Sequences: 5004 Number of extensions: 27883 Number of successful extensions: 66 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 158122380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -