BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1675 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 3.8 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 3.8 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 3.8 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 8.7 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 8.7 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 8.7 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 152 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 205 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 3.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 324 EKEKNKFLNGIENFDPTKLKHTETCDKNPLPTKDVIEQE 440 EKE+ K L+ E + K + E DK+ +DV E E Sbjct: 216 EKEREKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGEDE 254 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 92 TSPRSPQT*RVSSKASTPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYS-TVSRS 250 ++PRS SS + S S+ ++ RLL +P+ YS T+ S Sbjct: 143 STPRSSPAETASSLSPQSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNS 196 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 217 SSQWRRLQQTEAQSFHWCRRHGDS 146 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 217 SSQWRRLQQTEAQSFHWCRRHGDS 146 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.0 bits (42), Expect = 8.7 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 368 SH*AEAHGNVRQEPAPHKGRH*AREISLNHYFITVT 475 +H E + +V++EP R + LNH+ +VT Sbjct: 40 THNNEMYHSVKEEPIYESCRFSINQPYLNHFDNSVT 75 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 217 SSQWRRLQQTEAQSFHWCRRHGDS 146 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,274 Number of Sequences: 336 Number of extensions: 3439 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -