BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1672X (558 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80437-19|AAB37630.2| 580|Caenorhabditis elegans Conserved olig... 31 0.43 AC006642-4|AAF39830.1| 257|Caenorhabditis elegans Hypothetical ... 31 0.74 AF067609-1|ABB51195.1| 394|Caenorhabditis elegans Hypothetical ... 30 0.98 AC024776-11|AAK68461.1| 349|Caenorhabditis elegans Hypothetical... 30 0.98 Z22174-3|CAE17880.1| 125|Caenorhabditis elegans Hypothetical pr... 29 2.3 Z35663-11|CAA84732.2| 791|Caenorhabditis elegans Hypothetical p... 29 3.0 Z81502-2|CAB04106.2| 720|Caenorhabditis elegans Hypothetical pr... 28 4.0 Z82282-4|CAB05276.1| 485|Caenorhabditis elegans Hypothetical pr... 27 6.9 Z73969-20|CAA98241.1| 643|Caenorhabditis elegans Hypothetical p... 27 6.9 U21487-1|AAA96949.1| 643|Caenorhabditis elegans ribonucleoprote... 27 6.9 U14635-7|AAC46658.2| 521|Caenorhabditis elegans Hypothetical pr... 27 6.9 U14635-6|AAP86617.1| 517|Caenorhabditis elegans Hypothetical pr... 27 6.9 L41729-1|AAC41575.1| 643|Caenorhabditis elegans Ro ribonucleopr... 27 6.9 AL021479-8|CAA16325.1| 643|Caenorhabditis elegans Hypothetical ... 27 6.9 Z75550-4|CAA99923.2| 335|Caenorhabditis elegans Hypothetical pr... 27 9.1 >U80437-19|AAB37630.2| 580|Caenorhabditis elegans Conserved oligomeric golgi (cog)component protein 5 protein. Length = 580 Score = 31.5 bits (68), Expect = 0.43 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 404 LDDLFRKTKTTPCIYWLPLSAETV 475 LD LF+KT P IY+LPL+ E + Sbjct: 517 LDQLFKKTVALPPIYYLPLTEEQI 540 >AC006642-4|AAF39830.1| 257|Caenorhabditis elegans Hypothetical protein F49H12.5 protein. Length = 257 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/69 (23%), Positives = 35/69 (50%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLRKDDIGPQKGAPNQR 362 +E+ K E +VEK E+K ++ + + K + D K +K+D +K +++ Sbjct: 176 KEEAKKEEKKVEKKEEKKDKKKDEKKEEKKEKKEDKKKDEKKKDKKKEDKKDKKDKKDKK 235 Query: 363 ENSKRKKKR 389 + +K+K+ Sbjct: 236 DKKDKKEKK 244 >AF067609-1|ABB51195.1| 394|Caenorhabditis elegans Hypothetical protein C23H5.11 protein. Length = 394 Score = 30.3 bits (65), Expect = 0.98 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 5/37 (13%) Frame = -2 Query: 221 LFHF-----CLSFQILLPKPILNCSWNCRRWSTLCFL 126 LFHF CL F I L +LNC CRRWS++ ++ Sbjct: 101 LFHFVISTLCLCFTIRLLL-LLNCIRRCRRWSSVSWV 136 >AC024776-11|AAK68461.1| 349|Caenorhabditis elegans Hypothetical protein Y41D4B.11 protein. Length = 349 Score = 30.3 bits (65), Expect = 0.98 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLRKDDI--GPQKGAPN 356 REQ+ +R EVEK E+K + M + K + E S D V ++ I +KG Sbjct: 162 REQEARRLEEVEKLKEQKKAEKRKMKEALEKEEEEESFDEDEVSEKRAKIEKSTEKGGSE 221 Query: 357 QRENSKRKKKRLLQNYLMIYLEKQKQ 434 + KK R + ++QK+ Sbjct: 222 KATTKLSKKDRRKETLKARKSDEQKR 247 >Z22174-3|CAE17880.1| 125|Caenorhabditis elegans Hypothetical protein K01B6.4 protein. Length = 125 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 288 TSCDVKSVHLRKDDIGPQKGAPNQRENSKRKK 383 T CD++SV +RKDD ++ +++N K K Sbjct: 19 TDCDLQSVTIRKDDHNTKEDPVTEKKNLKVSK 50 >Z35663-11|CAA84732.2| 791|Caenorhabditis elegans Hypothetical protein T04A8.13 protein. Length = 791 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/68 (26%), Positives = 32/68 (47%) Frame = +3 Query: 186 EQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLRKDDIGPQKGAPNQRE 365 E++ K E + E E+K +E K+E S D K ++D K N+ + Sbjct: 77 EKEKKEEEKKEDGHEKKEDKKEDKKENENDEKKEKSKDDKKEESKEDKKEKTKTEDNEGK 136 Query: 366 NSKRKKKR 389 N ++KK++ Sbjct: 137 NEEKKKEK 144 >Z81502-2|CAB04106.2| 720|Caenorhabditis elegans Hypothetical protein F14B6.2 protein. Length = 720 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -3 Query: 316 RWTLFTSQLVSLFVFIIFAYIHSLIVPLRS 227 RW+LF +V F+F++ ++ SL + + S Sbjct: 624 RWSLFVLHIVFDFLFLVVGFVTSLTIAIMS 653 >Z82282-4|CAB05276.1| 485|Caenorhabditis elegans Hypothetical protein T07G12.4 protein. Length = 485 Score = 27.5 bits (58), Expect = 6.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -1 Query: 156 LPKVEHSLLPHWIMLCQMLLLL 91 +P +EH + HWI + ++L+L+ Sbjct: 103 IPDIEHKVSLHWISIIEILILI 124 >Z73969-20|CAA98241.1| 643|Caenorhabditis elegans Hypothetical protein C12D8.11 protein. Length = 643 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLR 320 R+ ++ AEVEK W++K + ++IK ++ + ++ +L+ Sbjct: 294 RKMSVEEVAEVEKVWDKKALKLPYTEEQLIKEEQSRALNLVEAYLK 339 >U21487-1|AAA96949.1| 643|Caenorhabditis elegans ribonucleoprotein Ro autoantigenhomolog protein. Length = 643 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLR 320 R+ ++ AEVEK W++K + ++IK ++ + ++ +L+ Sbjct: 294 RKMSVEEVAEVEKVWDKKALKLPYTEEQLIKEEQSRALNLVEAYLK 339 >U14635-7|AAC46658.2| 521|Caenorhabditis elegans Hypothetical protein C27H5.4a protein. Length = 521 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -3 Query: 343 FWGPMSSFLRWTLFTSQLVSLFVF------IIFAYIHSLIVPLRSHD 221 FW P S+ + W LVSLF++ ++ AY + RSH+ Sbjct: 101 FWFPWSTSIGWVTALHLLVSLFIYDTLLTLVLSAYCGLCVENSRSHE 147 >U14635-6|AAP86617.1| 517|Caenorhabditis elegans Hypothetical protein C27H5.4b protein. Length = 517 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -3 Query: 343 FWGPMSSFLRWTLFTSQLVSLFVF------IIFAYIHSLIVPLRSHD 221 FW P S+ + W LVSLF++ ++ AY + RSH+ Sbjct: 97 FWFPWSTSIGWVTALHLLVSLFIYDTLLTLVLSAYCGLCVENSRSHE 143 >L41729-1|AAC41575.1| 643|Caenorhabditis elegans Ro ribonucleoprotein autoantigen protein. Length = 643 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLR 320 R+ ++ AEVEK W++K + ++IK ++ + ++ +L+ Sbjct: 294 RKMSVEEVAEVEKVWDKKALKLPYTEEQLIKEEQSRALNLVEAYLK 339 >AL021479-8|CAA16325.1| 643|Caenorhabditis elegans Hypothetical protein C12D8.11 protein. Length = 643 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = +3 Query: 183 REQDLKREAEVEKSWERKGTMREWM*AKMIKTKRETSCDVKSVHLR 320 R+ ++ AEVEK W++K + ++IK ++ + ++ +L+ Sbjct: 294 RKMSVEEVAEVEKVWDKKALKLPYTEEQLIKEEQSRALNLVEAYLK 339 >Z75550-4|CAA99923.2| 335|Caenorhabditis elegans Hypothetical protein T22C1.6 protein. Length = 335 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +3 Query: 216 EKSWERKGTMREWM*AKMIKTKRET-SCDVKSVHLRKDDIGPQKGAPNQRENSKRKKKRL 392 EK WE G ++ + K++ K E+ S VK + KD++ R K ++ Sbjct: 168 EKYWEEYGKTKD-LEIKLLTAKLESASIQVKKSGMEKDELAKIMLEETARVGGALKTEKA 226 Query: 393 LQNYLMIYLEKQKQL 437 L+ + Y K +L Sbjct: 227 LREQVQEYSAKYSEL 241 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,554,850 Number of Sequences: 27780 Number of extensions: 214591 Number of successful extensions: 689 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -