BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1671X (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_23281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) 28 6.5 >SB_53260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +2 Query: 155 FERETSIDQFSINVYKVRSVGIPTIAQFDYSY*DRPVRTCLSDINVFNKLILIFI 319 F R S + N Y+V G+P +A+F + C +D+N +++F+ Sbjct: 60 FSRHVSFPDATRNAYRVTEQGLPKVAEFAMDAAVKFRDYCANDLNTDVTKMMVFV 114 >SB_23281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 256 ILITIIKLRNSRYSDATYFIHINRELVYRRF-ALKG 152 +L+ IIK + SR++D F + +YR F AL G Sbjct: 2 MLLEIIKKKKSRFADRRRFTRARKSKMYRAFLALSG 37 >SB_45862| Best HMM Match : GMP_synt_C (HMM E-Value=0) Length = 687 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +3 Query: 459 LISLSTKYCISSKL*PIRDEGITYRARSYRSAVSPRGGEHP 581 L+ +++KY I++ L PI+ G+ RSY V+ + P Sbjct: 128 LLIITSKYKIAASLLPIKSVGVQGDGRSYSYVVALSSNDKP 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,836,791 Number of Sequences: 59808 Number of extensions: 297370 Number of successful extensions: 497 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -