SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1670
         (633 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.     25   0.46 
DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2 pr...    21   7.5  
DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1 pr...    21   7.5  
AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-ri...    21   7.5  
AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.    21   7.5  

>AB072429-1|BAB83990.1|  388|Apis mellifera IP3phosphatase protein.
          Length = 388

 Score = 25.4 bits (53), Expect = 0.46
 Identities = 14/52 (26%), Positives = 29/52 (55%)
 Frame = -1

Query: 288 AKTRPYRSIPNTIIKLRNSRYSDATYFIHINRELVYRRFALKGLTKVNEDSE 133
           +KTR  R++ +T+ +  N +YS+  YF+    +  +R      + K+ ED++
Sbjct: 199 SKTRR-RALEHTLDRFHNDKYSNVPYFLF--GDFNFRTDTAGVIKKLTEDTQ 247


>DQ485319-1|ABF21078.1|  175|Apis mellifera icarapin variant 2
           precursor protein.
          Length = 175

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 550 VPERGVTAWGRTP 588
           +PE+GV  W + P
Sbjct: 62  IPEQGVVNWNKIP 74


>DQ485318-1|ABF21077.1|  223|Apis mellifera icarapin variant 1
           precursor protein.
          Length = 223

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 550 VPERGVTAWGRTP 588
           +PE+GV  W + P
Sbjct: 110 IPEQGVVNWNKIP 122


>AY939856-1|AAX33236.1|  223|Apis mellifera venom carbohydrate-rich
           protein precursor protein.
          Length = 223

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 550 VPERGVTAWGRTP 588
           +PE+GV  W + P
Sbjct: 110 IPEQGVVNWNKIP 122


>AY897570-1|AAW81036.1|  223|Apis mellifera venom protein 2 protein.
          Length = 223

 Score = 21.4 bits (43), Expect = 7.5
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 550 VPERGVTAWGRTP 588
           +PE+GV  W + P
Sbjct: 110 IPEQGVVNWNKIP 122


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,153
Number of Sequences: 438
Number of extensions: 3205
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18949215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -