BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1668 (697 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Dros... 106 3e-23 X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Dros... 106 3e-23 BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p pro... 106 3e-23 AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p pro... 106 3e-23 AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA... 106 3e-23 DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup prote... 32 0.65 DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup prote... 32 0.65 DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup prote... 32 0.65 DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup prote... 32 0.65 AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p pro... 32 0.65 AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transm... 32 0.65 AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-P... 32 0.65 BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p pro... 30 2.6 AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p pro... 30 2.6 AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA... 30 2.6 BT023938-1|ABB36442.1| 1103|Drosophila melanogaster RE04201p pro... 30 3.5 AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p pro... 30 3.5 AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-P... 30 3.5 AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-P... 30 3.5 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 30 3.5 AE014134-2941|AAF53675.2| 1365|Drosophila melanogaster CG10231-P... 29 6.0 >X13382-1|CAA31759.1| 407|Drosophila melanogaster protein ( Drosophila melanogastermRNA for put. ribosomal protein L1. ). Length = 407 Score = 106 bits (254), Expect = 3e-23 Identities = 49/93 (52%), Positives = 59/93 (63%) Frame = +1 Query: 241 GYRTCVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXX 420 G VARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 71 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSA 130 Query: 421 XXXXXXXXXXQARGHIIEKIPELPLVVADKSRR 519 Q++GH+I+ + E PLVV+D+ ++ Sbjct: 131 IAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK 163 Score = 101 bits (242), Expect = 9e-22 Identities = 46/72 (63%), Positives = 59/72 (81%) Frame = +3 Query: 480 SRASLGCSRQVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGP 659 S L S +VQ++ KTKQAVIFLRRLK W+DI KVYKSQR RAG+G MR+RRRI R+GP Sbjct: 151 SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGP 210 Query: 660 LIIFNKDQGLTR 695 L++++KD+GL + Sbjct: 211 LVVYDKDEGLRK 222 Score = 81.8 bits (193), Expect = 8e-16 Identities = 41/75 (54%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 38 SIGSPTFSVGVFREE*DGAGSAKP-LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 214 S+G+ V V+ E+ + A LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ A Sbjct: 2 SLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELA 61 Query: 215 GHQTSAESWGTGRVL 259 GHQTSAESWGTGR + Sbjct: 62 GHQTSAESWGTGRAV 76 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 33 MSLSVARPLVSVYSEKSE 86 MSL ARPLVSVY+EK+E Sbjct: 1 MSLGNARPLVSVYTEKNE 18 >X06881-1|CAA29998.1| 123|Drosophila melanogaster protein ( Drosophila gene forribosomal protein L1 fragment. ). Length = 123 Score = 106 bits (254), Expect = 3e-23 Identities = 49/93 (52%), Positives = 59/93 (63%) Frame = +1 Query: 241 GYRTCVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXX 420 G VARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 9 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRRVNVNQRRYALVSA 68 Query: 421 XXXXXXXXXXQARGHIIEKIPELPLVVADKSRR 519 Q++GH+I+ + E PLVV+D+ ++ Sbjct: 69 IAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK 101 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +3 Query: 480 SRASLGCSRQVQEINKTKQAVIFLRRLKAWSDILK 584 S L S +VQ++ KTKQAVIFLRRLK W+DI K Sbjct: 89 SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQK 123 Score = 31.9 bits (69), Expect = 0.86 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 218 HQTSAESWGTGRVL 259 HQTSAESWGTGR + Sbjct: 1 HQTSAESWGTGRAV 14 >BT025959-1|ABG02203.1| 233|Drosophila melanogaster IP15855p protein. Length = 233 Score = 106 bits (254), Expect = 3e-23 Identities = 49/93 (52%), Positives = 59/93 (63%) Frame = +1 Query: 241 GYRTCVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXX 420 G VARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 71 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSA 130 Query: 421 XXXXXXXXXXQARGHIIEKIPELPLVVADKSRR 519 Q++GH+I+ + E PLVV+D+ ++ Sbjct: 131 IAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK 163 Score = 101 bits (242), Expect = 9e-22 Identities = 46/72 (63%), Positives = 59/72 (81%) Frame = +3 Query: 480 SRASLGCSRQVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGP 659 S L S +VQ++ KTKQAVIFLRRLK W+DI KVYKSQR RAG+G MR+RRRI R+GP Sbjct: 151 SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGP 210 Query: 660 LIIFNKDQGLTR 695 L++++KD+GL + Sbjct: 211 LVVYDKDEGLRK 222 Score = 81.8 bits (193), Expect = 8e-16 Identities = 41/75 (54%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 38 SIGSPTFSVGVFREE*DGAGSAKP-LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 214 S+G+ V V+ E+ + A LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ A Sbjct: 2 SLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELA 61 Query: 215 GHQTSAESWGTGRVL 259 GHQTSAESWGTGR + Sbjct: 62 GHQTSAESWGTGRAV 76 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 33 MSLSVARPLVSVYSEKSE 86 MSL ARPLVSVY+EK+E Sbjct: 1 MSLGNARPLVSVYTEKNE 18 >AY069485-1|AAL39630.1| 401|Drosophila melanogaster LD21756p protein. Length = 401 Score = 106 bits (254), Expect = 3e-23 Identities = 49/93 (52%), Positives = 59/93 (63%) Frame = +1 Query: 241 GYRTCVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXX 420 G VARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 71 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSA 130 Query: 421 XXXXXXXXXXQARGHIIEKIPELPLVVADKSRR 519 Q++GH+I+ + E PLVV+D+ ++ Sbjct: 131 IAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK 163 Score = 101 bits (242), Expect = 9e-22 Identities = 46/72 (63%), Positives = 59/72 (81%) Frame = +3 Query: 480 SRASLGCSRQVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGP 659 S L S +VQ++ KTKQAVIFLRRLK W+DI KVYKSQR RAG+G MR+RRRI R+GP Sbjct: 151 SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGP 210 Query: 660 LIIFNKDQGLTR 695 L++++KD+GL + Sbjct: 211 LVVYDKDEGLRK 222 Score = 81.8 bits (193), Expect = 8e-16 Identities = 41/75 (54%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 38 SIGSPTFSVGVFREE*DGAGSAKP-LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 214 S+G+ V V+ E+ + A LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ A Sbjct: 2 SLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELA 61 Query: 215 GHQTSAESWGTGRVL 259 GHQTSAESWGTGR + Sbjct: 62 GHQTSAESWGTGRAV 76 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 33 MSLSVARPLVSVYSEKSE 86 MSL ARPLVSVY+EK+E Sbjct: 1 MSLGNARPLVSVYTEKNE 18 >AE014297-4196|AAG22173.1| 401|Drosophila melanogaster CG5502-PA protein. Length = 401 Score = 106 bits (254), Expect = 3e-23 Identities = 49/93 (52%), Positives = 59/93 (63%) Frame = +1 Query: 241 GYRTCVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXX 420 G VARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK +RRWH Sbjct: 71 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSA 130 Query: 421 XXXXXXXXXXQARGHIIEKIPELPLVVADKSRR 519 Q++GH+I+ + E PLVV+D+ ++ Sbjct: 131 IAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK 163 Score = 101 bits (242), Expect = 9e-22 Identities = 46/72 (63%), Positives = 59/72 (81%) Frame = +3 Query: 480 SRASLGCSRQVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRKGP 659 S L S +VQ++ KTKQAVIFLRRLK W+DI KVYKSQR RAG+G MR+RRRI R+GP Sbjct: 151 SEFPLVVSDEVQKVQKTKQAVIFLRRLKIWADIQKVYKSQRFRAGRGTMRDRRRIARRGP 210 Query: 660 LIIFNKDQGLTR 695 L++++KD+GL + Sbjct: 211 LVVYDKDEGLRK 222 Score = 81.8 bits (193), Expect = 8e-16 Identities = 41/75 (54%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +2 Query: 38 SIGSPTFSVGVFREE*DGAGSAKP-LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 214 S+G+ V V+ E+ + A LP VFKAPIRPD+VN+VH + +N+RQ Y VS+ A Sbjct: 2 SLGNARPLVSVYTEKNEPAKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELA 61 Query: 215 GHQTSAESWGTGRVL 259 GHQTSAESWGTGR + Sbjct: 62 GHQTSAESWGTGRAV 76 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 33 MSLSVARPLVSVYSEKSE 86 MSL ARPLVSVY+EK+E Sbjct: 1 MSLGNARPLVSVYTEKNE 18 >DQ375985-1|ABD37876.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375984-1|ABD37875.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375983-1|ABD37874.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375982-1|ABD37873.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375981-1|ABD37872.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375980-1|ABD37871.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375979-1|ABD37870.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375978-1|ABD37869.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375976-1|ABD37867.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375975-1|ABD37866.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375974-1|ABD37865.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375973-1|ABD37864.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375972-1|ABD37863.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375971-1|ABD37862.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375970-1|ABD37861.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375969-1|ABD37860.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375968-1|ABD37859.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375967-1|ABD37858.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375965-1|ABD37856.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375964-1|ABD37855.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375963-1|ABD37854.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375962-1|ABD37853.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375961-1|ABD37852.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375960-1|ABD37851.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375959-1|ABD37850.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375958-1|ABD37849.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375957-1|ABD37848.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375956-1|ABD37847.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375953-1|ABD37844.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375952-1|ABD37843.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375951-1|ABD37842.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375950-1|ABD37841.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375949-1|ABD37840.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375948-1|ABD37839.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375947-1|ABD37838.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375946-1|ABD37837.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375945-1|ABD37836.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375944-1|ABD37835.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375943-1|ABD37834.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375942-1|ABD37833.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375941-1|ABD37832.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375940-1|ABD37831.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375939-1|ABD37830.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375938-1|ABD37829.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375937-1|ABD37828.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375936-1|ABD37827.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375935-1|ABD37826.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375934-1|ABD37825.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375933-1|ABD37824.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375932-1|ABD37823.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375931-1|ABD37822.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375930-1|ABD37821.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375929-1|ABD37820.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375928-1|ABD37819.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375927-1|ABD37818.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375926-1|ABD37817.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375925-1|ABD37816.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375924-1|ABD37815.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375922-1|ABD37813.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375921-1|ABD37812.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375920-1|ABD37811.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375919-1|ABD37810.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375918-1|ABD37809.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375917-1|ABD37808.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375916-1|ABD37807.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375915-1|ABD37806.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375914-1|ABD37805.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375913-1|ABD37804.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375911-1|ABD37802.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375910-1|ABD37801.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375909-1|ABD37800.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375908-1|ABD37799.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375907-1|ABD37798.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375906-1|ABD37797.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375904-1|ABD37795.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375903-1|ABD37794.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375902-1|ABD37793.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375901-1|ABD37792.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375900-1|ABD37791.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 105 >DQ375899-1|ABD37790.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375898-1|ABD37789.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375897-1|ABD37788.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375896-1|ABD37787.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375895-1|ABD37786.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375894-1|ABD37785.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375893-1|ABD37784.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375892-1|ABD37783.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375891-1|ABD37782.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375890-1|ABD37781.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375889-1|ABD37780.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375888-1|ABD37779.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375887-1|ABD37778.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375886-1|ABD37777.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375885-1|ABD37776.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375884-1|ABD37775.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375883-1|ABD37774.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375882-1|ABD37773.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375881-1|ABD37772.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375880-1|ABD37771.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375879-1|ABD37770.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375878-1|ABD37769.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375877-1|ABD37768.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375876-1|ABD37767.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375875-1|ABD37766.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375874-1|ABD37765.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375873-1|ABD37764.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375872-1|ABD37763.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375871-1|ABD37762.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375870-1|ABD37761.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375869-1|ABD37760.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375868-1|ABD37759.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375867-1|ABD37758.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375866-1|ABD37757.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375865-1|ABD37756.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375864-1|ABD37755.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375863-1|ABD37754.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375862-1|ABD37753.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375861-1|ABD37752.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375860-1|ABD37751.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375859-1|ABD37750.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375858-1|ABD37749.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375856-1|ABD37747.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375855-1|ABD37746.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375854-1|ABD37745.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375853-1|ABD37744.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375852-1|ABD37743.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375851-1|ABD37742.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375850-1|ABD37741.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375849-1|ABD37740.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375848-1|ABD37739.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375847-1|ABD37738.1| 430|Drosophila melanogaster catsup protein protein. Length = 430 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 76 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 105 >DQ375846-1|ABD37737.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375845-1|ABD37736.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375844-1|ABD37735.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375843-1|ABD37734.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375842-1|ABD37733.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375841-1|ABD37732.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375840-1|ABD37731.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375838-1|ABD37729.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375837-1|ABD37728.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375836-1|ABD37727.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375835-1|ABD37726.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375833-1|ABD37724.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375832-1|ABD37723.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375831-1|ABD37722.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375830-1|ABD37721.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375829-1|ABD37720.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375828-1|ABD37719.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375827-1|ABD37718.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375826-1|ABD37717.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375825-1|ABD37716.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375824-1|ABD37715.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375823-1|ABD37714.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375822-1|ABD37713.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375821-1|ABD37712.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375820-1|ABD37711.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375819-1|ABD37710.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375818-1|ABD37709.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 Score = 29.5 bits (63), Expect = 4.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 304 DRTYGYHHHGHAEFGQHTSG 245 DR +G+HHHGH H G Sbjct: 71 DRDHGHHHHGHDHDHDHDHG 90 >DQ375817-1|ABD37708.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375816-1|ABD37707.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >DQ375815-1|ABD37706.1| 449|Drosophila melanogaster catsup protein protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >AY058528-1|AAL13757.1| 449|Drosophila melanogaster LD23513p protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >AF216584-1|AAF37226.1| 449|Drosophila melanogaster seven transmembrane protein Catecholaminesup protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >AE014134-3021|AAF53744.1| 449|Drosophila melanogaster CG10449-PA protein. Length = 449 Score = 32.3 bits (70), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 HH + D +G+HHHGH E +HT P Sbjct: 95 HHHHGHDHDHDHDHGHHHHGHDE--RHTKAKP 124 >BT003320-1|AAO25080.1| 798|Drosophila melanogaster AT11823p protein. Length = 798 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 H D+ RH R + +HHH H QH P Sbjct: 384 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 415 >AY069327-1|AAL39472.2| 552|Drosophila melanogaster LD04591p protein. Length = 552 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 H D+ RH R + +HHH H QH P Sbjct: 138 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 169 >AE014297-4076|AAF56673.2| 980|Drosophila melanogaster CG6051-PA protein. Length = 980 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP 239 H D+ RH R + +HHH H QH P Sbjct: 566 HRDSHSHRHHQRHHHHHHHRHPHQHQHRQPHP 597 >BT023938-1|ABB36442.1| 1103|Drosophila melanogaster RE04201p protein. Length = 1103 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP*FGTGLVTSLLAHAVGLPRVL 176 HH + H + HH H G +S + ++S LA A GL R++ Sbjct: 1009 HHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1061 >AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p protein. Length = 1413 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP*FGTGLVTSLLAHAVGLPRVL 176 HH + H + HH H G +S + ++S LA A GL R++ Sbjct: 1319 HHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1371 >AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-PA, isoform A protein. Length = 1413 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP*FGTGLVTSLLAHAVGLPRVL 176 HH + H + HH H G +S + ++S LA A GL R++ Sbjct: 1319 HHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1371 >AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-PB, isoform B protein. Length = 1700 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSGTP*FGTGLVTSLLAHAVGLPRVL 176 HH + H + HH H G +S + ++S LA A GL R++ Sbjct: 1606 HHQHQHHMHHSHHMHHAHHPHTGMGGSSSNSSSSTAAAISSSLAQAGGLRRIV 1658 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 29.9 bits (64), Expect = 3.5 Identities = 33/107 (30%), Positives = 45/107 (42%), Gaps = 9/107 (8%) Frame = +3 Query: 225 PVP-NHGVPDVCCPNSACPWWWYP*VRSGCLR*HVSWWTYVRPHEALAALAPSR------ 383 PVP N VP C PNS C V S C+ ++ Y RP L++ PS Sbjct: 9522 PVPKNPCVPSPCGPNSICQIKQNRPVCS-CVANYIGSPPYCRPECTLSSECPSDKACINE 9580 Query: 384 --QPPTAESGLGSSRCCYWRPSARSG*RTHY*KDSRASLGCSRQVQE 518 Q P A ++RC SA Y + A +GCS+++ E Sbjct: 9581 KCQNPCANVCGHNARCTVIAHSAHCSCDEDY--EGDAFIGCSKKITE 9625 >AE014134-2941|AAF53675.2| 1365|Drosophila melanogaster CG10231-PA protein. Length = 1365 Score = 29.1 bits (62), Expect = 6.0 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 7/61 (11%) Frame = -1 Query: 334 HHDTCYRRHPDRTYGYHHHGHAEFGQHTSG---TP*FGTGLV---TSLLA-HAVGLPRVL 176 HH+ + + + + +HHH H QH G G+GL+ T LLA + +P+++ Sbjct: 1245 HHNHSHSHNHNHHHHHHHHSHHNHSQHGIGIGSASIGGSGLISLTTPLLAMDSDRIPKIV 1304 Query: 175 G 173 G Sbjct: 1305 G 1305 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,727,997 Number of Sequences: 53049 Number of extensions: 722464 Number of successful extensions: 4141 Number of sequences better than 10.0: 178 Number of HSP's better than 10.0 without gapping: 3180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3939 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -