BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1666 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|c... 37 0.002 SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|ch... 29 0.86 SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo... 26 4.6 SPCC550.15c |||ribosome biogenesis protein |Schizosaccharomyces ... 26 6.0 SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo... 25 8.0 SPBC1709.14 |||peptide N-glycanase |Schizosaccharomyces pombe|ch... 25 8.0 SPCC594.02c |||conserved fungal protein|Schizosaccharomyces pomb... 25 8.0 >SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 37.1 bits (82), Expect = 0.002 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +2 Query: 335 GKHIYNFTCTLPPVLPSSFEGEHGYVRYTVKVTLDR 442 G++ YNF +P P S E + G+VRY ++ T++R Sbjct: 273 GEYTYNFDLAIPNCFPESVEAKMGWVRYFLEATVER 308 >SPBC839.02 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 530 Score = 28.7 bits (61), Expect = 0.86 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 335 GKHIYNFTCTLPPVLPSSFEGEHGYVRYTVKVTLDRPWKF 454 G+++YNF + P S + + G V Y ++ +DR F Sbjct: 191 GEYVYNFELPISCTYPESIQTDMGRVYYFLETLVDRSSTF 230 >SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 26.2 bits (55), Expect = 4.6 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +1 Query: 520 KEPIHIQLEKTFCCFCCASPPLAVDVQAPVSGYCPGQVIPLKIDIEIRAMSNF 678 ++ I + TFC C A V+ CP IPL ID+ A+ +F Sbjct: 719 QDAIESRCHHTFCRLCVTEYINAAGDGENVN--CPSCFIPLSIDLSAPALEDF 769 >SPCC550.15c |||ribosome biogenesis protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 463 Score = 25.8 bits (54), Expect = 6.0 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 135 QKHIRSFHSLFVLHNMYSIDYPNRY 61 +KH+++ HSL++ Y +D P+ + Sbjct: 224 KKHMKASHSLYIPEREYLVDEPSLF 248 >SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharomyces pombe|chr 2|||Manual Length = 1309 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 495 WI*ISSILQGTNPHSIRKDVLLFLLRITTFSSGCAG 602 WI S+L GT+ + I ++ L+R F S G Sbjct: 302 WILSKSLLSGTDAYQIEREQAFRLIRTLYFLSSTEG 337 >SPBC1709.14 |||peptide N-glycanase |Schizosaccharomyces pombe|chr 2|||Manual Length = 333 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 396 PSKDEGRTGGNVQVKLYMCFPCGISISFP 310 P +E + G V+LY C CG + FP Sbjct: 119 PPNEEEKWNGVRNVELYQCNVCGHNQRFP 147 >SPCC594.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 489 Score = 25.4 bits (53), Expect = 8.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 446 WKFDQETKMAFTVINALDLNLIHLTRNQSTFN 541 WK K TV N D++L+H+ R + F+ Sbjct: 11 WKKYFSNKKKPTVKNTSDIDLLHINRGRQPFD 42 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,087,874 Number of Sequences: 5004 Number of extensions: 69066 Number of successful extensions: 180 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -