BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1666 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 4.1 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.1 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.2 bits (50), Expect = 4.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 556 CCFCCAS 576 CCFCCAS Sbjct: 549 CCFCCAS 555 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.4 bits (48), Expect = 7.1 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +3 Query: 528 NPHSIRKDVLLFLLRITTFSSGCAGSCIWLLSRSSNTFENRH*NKSNVQLHLVKIFL 698 +P + +D++ L S+G + IW L S R KS QL +K+FL Sbjct: 432 DPLATEEDIIAALDAKIGASAGVVSASIWELPDGSKRARIRLPVKSARQLEGLKLFL 488 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,891 Number of Sequences: 2352 Number of extensions: 17584 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -