BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= br--1666
(704 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 24 4.1
M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.1
>AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin
GPCR protein.
Length = 634
Score = 24.2 bits (50), Expect = 4.1
Identities = 7/7 (100%), Positives = 7/7 (100%)
Frame = +1
Query: 556 CCFCCAS 576
CCFCCAS
Sbjct: 549 CCFCCAS 555
>M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles
gambiae RT2 retroposon. ).
Length = 574
Score = 23.4 bits (48), Expect = 7.1
Identities = 17/57 (29%), Positives = 26/57 (45%)
Frame = +3
Query: 528 NPHSIRKDVLLFLLRITTFSSGCAGSCIWLLSRSSNTFENRH*NKSNVQLHLVKIFL 698
+P + +D++ L S+G + IW L S R KS QL +K+FL
Sbjct: 432 DPLATEEDIIAALDAKIGASAGVVSASIWELPDGSKRARIRLPVKSARQLEGLKLFL 488
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 775,891
Number of Sequences: 2352
Number of extensions: 17584
Number of successful extensions: 13
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71922660
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -