BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1663 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces po... 28 1.6 SPAC11G7.05c |||[acyl-carrier protein] S-malonyltransferase Mct1... 28 1.6 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 26 6.5 SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogam... 25 8.6 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 25 8.6 SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces po... 25 8.6 >SPCP1E11.05c |||sterol O-acyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 472 Score = 27.9 bits (59), Expect = 1.6 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +2 Query: 2 FTKTWPSQKKHGMGLLRTSAYSATFNAMIWRITFLTQIILLRCCKSRWS 148 F +P QK +G LR +++ + FL+ +L RCC S WS Sbjct: 117 FLLAFPFQKIFALGYLRWYGLGVYLYSILI-LLFLSHCVL-RCCLSNWS 163 >SPAC11G7.05c |||[acyl-carrier protein] S-malonyltransferase Mct1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 318 Score = 27.9 bits (59), Expect = 1.6 Identities = 20/79 (25%), Positives = 32/79 (40%) Frame = -2 Query: 652 LGRL*RNNWSFLHRSFVFQSYVMAVDLINRQFDIASHTFQSILCYEIKLKTLTTIFVLIT 473 LG+L R+NW + +F + + A D + LCY K I +T Sbjct: 195 LGKL-RSNWLDVSGAFHSRYMLPARDSLKNALGETEFNISPELCYTDSGKRFLPIISNVT 253 Query: 472 MSVPPKNGTSIE*KLLMNC 416 + P + I +LL+ C Sbjct: 254 AELYPADEEDIRRQLLLQC 272 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 25.8 bits (54), Expect = 6.5 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 569 QSSI*HCKPYISEYPLL*NKTENVDDNFRIDNNVSASQKWH 447 QS + +C E ++ E + D+F +DN+V AS K H Sbjct: 2152 QSDVLYCTRVQKERFASVDEYEKLKDSFIVDNSVLASAKSH 2192 >SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogamy |Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.4 bits (53), Expect = 8.6 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -3 Query: 624 VSFIAVSCFKVTLWLSI*SIVNLTL 550 + FI + CFK+T W+++ + T+ Sbjct: 409 IIFIHIYCFKITSWVNLYGWITCTI 433 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.4 bits (53), Expect = 8.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 470 HCYQYENCRQRFQ 508 HC ENCR+R+Q Sbjct: 226 HCLNSENCRRRYQ 238 >SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 25.4 bits (53), Expect = 8.6 Identities = 20/88 (22%), Positives = 43/88 (48%) Frame = +1 Query: 82 DDMEDHISNADHLAKMLQVEVEFRIYNGLYRMMDNSFQCLTCNEVFRLVKTSIQACVTHI 261 DD+E ++ +H + + +++ L+RM+ N + +E L+ I+ ++I Sbjct: 368 DDLESYLIRRNHFLSFPLCKEQIQLHTDLFRMIING--VMYVHEGVNLIHRDIKP--SNI 423 Query: 262 FYAPNISRYKKNWQRLQKMPLILYNLKS 345 F A ++ + + +PLI YN K+ Sbjct: 424 FLAKSLPEDRGS------VPLISYNDKN 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,087,550 Number of Sequences: 5004 Number of extensions: 63042 Number of successful extensions: 215 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 215 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -