BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1658 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 24 1.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.8 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 9.0 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 9.0 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.0 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 9.0 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 81 LREKAFQDYRKKLMEHKEVESR 146 +RE+ + YR+ L+EHK+ +R Sbjct: 139 IREQTEEMYREMLLEHKKRRAR 160 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 655 KS*HRAVKPQPSRAKSFLYQEV 590 K HRA++P+P A+ + Q + Sbjct: 629 KKKHRAIRPEPIDAQFDIIQNI 650 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +1 Query: 91 RPSRITERSSWSIRKSSHDSKKVVTN*KI*PNNMTRVK 204 +P + RS+ + + D+ VVT K +N+T K Sbjct: 983 KPPSVVSRSTQTSANNDKDTNAVVTQSKEARDNITATK 1020 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 313 NNVARAISSFYNKF 272 NNV + ++ FYN F Sbjct: 521 NNVPKKLNMFYNNF 534 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 313 NNVARAISSFYNKF 272 NNV + ++ FYN F Sbjct: 521 NNVPKKLNMFYNNF 534 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 9.0 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +2 Query: 308 VVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNMSHED 448 +V C +DK +K +V T I R L +E ++ + H+D Sbjct: 431 IVKCTDFVDKAMVKQYVKVKHSATLGYISRVLEKEPYVIILDDEHDD 477 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 Query: 470 RNRSRHQDPHDSCCK 426 RN R DPHD K Sbjct: 178 RNERRTPDPHDETAK 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,707 Number of Sequences: 438 Number of extensions: 4455 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -