BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1654 (655 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 26 0.31 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 25 0.54 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 25 0.54 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 25 0.54 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 0.95 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 5.1 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 8.9 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 8.9 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.9 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 25.8 bits (54), Expect = 0.31 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 627 YGLLRIHNFITDLFHFVESLITITPYSLSVV*FCNLITLLN 505 Y L N+I DLF F P+ +S + +LI L N Sbjct: 210 YSTLHFVNYIDDLFFFRFEKSKFEPFLISNISLVSLIFLFN 250 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 25.0 bits (52), Expect = 0.54 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -3 Query: 419 ASSTVFP-LTHSVARELEAIAEPHPKVLNLASTIFPFSSTXICNFITSPHAGAPTRL-YL 246 A S ++P L S AIA + N+++TI PF+S +F R Sbjct: 240 APSVMYPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQYQMNQEYRTDRK 299 Query: 245 HFYLSYPMNQH 213 H Y MNQ+ Sbjct: 300 HTQQHYQMNQN 310 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 25.0 bits (52), Expect = 0.54 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -3 Query: 419 ASSTVFP-LTHSVARELEAIAEPHPKVLNLASTIFPFSSTXICNFITSPHAGAPTRL-YL 246 A S ++P L S AIA + N+++TI PF+S +F R Sbjct: 188 APSVMYPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQYQMNQEYRTDRK 247 Query: 245 HFYLSYPMNQH 213 H Y MNQ+ Sbjct: 248 HTQQHYQMNQN 258 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 25.0 bits (52), Expect = 0.54 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = -3 Query: 419 ASSTVFP-LTHSVARELEAIAEPHPKVLNLASTIFPFSSTXICNFITSPHAGAPTRL-YL 246 A S ++P L S AIA + N+++TI PF+S +F R Sbjct: 371 APSVMYPHLNRSSPTTATAIASATVTIQNVSNTIPPFASRGSMHFPNQYQMNQEYRTDRK 430 Query: 245 HFYLSYPMNQH 213 H Y MNQ+ Sbjct: 431 HTQQHYQMNQN 441 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 0.95 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 497 SASIEQ*SLTGGKDSSLAISVFFNFSASSTVFPLTHSVARELEAIAEPHPKVL 339 S I+ L GG +L + F N +PL ++ R L A+P PK + Sbjct: 2149 SEFIKAMGLGGGMIWALDLDDFKNLCGCEE-YPLLRTINRVLRGYAKPDPKCI 2200 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 388 EWVKGKTVDEALK-LKNTDIAK 450 +W KG+ DE LK L+N K Sbjct: 233 DWYKGRLTDEQLKELENPPTPK 254 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 213 MLVHWIRKIKM*VQPRWCTCMW 278 M+ H K K+ + RW CM+ Sbjct: 107 MIAHLKDKKKIRAKKRWSQCMY 128 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 213 MLVHWIRKIKM*VQPRWCTCMW 278 M+ H K K+ + RW CM+ Sbjct: 421 MIAHLKDKKKIRAKKRWSQCMY 442 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 213 MLVHWIRKIKM*VQPRWCTCMW 278 M+ H K K+ + RW CM+ Sbjct: 654 MIAHLKDKKKIRAKKRWSQCMY 675 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 213 MLVHWIRKIKM*VQPRWCTCMW 278 M+ H K K+ + RW CM+ Sbjct: 654 MIAHLKDKKKIRAKKRWSQCMY 675 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,191 Number of Sequences: 336 Number of extensions: 3088 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -