BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1653 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27970.1 68417.m04013 C4-dicarboxylate transporter/malic acid... 31 0.51 At5g18410.2 68418.m02167 expressed protein similar to p53 induci... 30 1.2 At5g18410.1 68418.m02166 expressed protein similar to p53 induci... 30 1.2 At5g16190.1 68418.m01892 glycosyl transferase family 2 protein s... 30 1.2 At2g41790.1 68415.m05165 peptidase M16 family protein / insulina... 28 4.8 At1g80540.1 68414.m09441 expressed protein ; expression supporte... 28 4.8 At5g13520.1 68418.m01561 peptidase M1 family protein similar to ... 28 6.3 At5g08030.1 68418.m00934 glycerophosphoryl diester phosphodieste... 28 6.3 At4g39180.1 68417.m05548 SEC14 cytosolic factor, putative / phos... 28 6.3 At1g03103.1 68414.m00286 protease inhibitor/seed storage/lipid t... 28 6.3 At3g42410.1 68416.m04385 replication protein-related weak simila... 27 8.4 >At4g27970.1 68417.m04013 C4-dicarboxylate transporter/malic acid transport family protein contains Pfam profile PF03595: C4-dicarboxylate transporter/malic acid transport protein Length = 519 Score = 31.5 bits (68), Expect = 0.51 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +3 Query: 207 KQEENAQGKTESTDTMIQEMKNISRFLTI--YWEVIQGMKLEYHKGNTYIILP 359 +Q N +GK T++ +Q+ K I+ LT Y++ +QG +LE K I+LP Sbjct: 82 RQISNLRGKP--TESSLQDHKEITESLTADRYFDALQGPELETLKEKEKIVLP 132 >At5g18410.2 68418.m02167 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1017 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 237 ESTDTMIQEMKNISRFLTIYWEVIQGMKLEYHKGNTY 347 + TDTM +E+ ++ FL+ W ++ + +E + N Y Sbjct: 195 QDTDTMREELDDLQIFLSTRWAILLNLHVEMFRVNKY 231 >At5g18410.1 68418.m02166 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1234 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 237 ESTDTMIQEMKNISRFLTIYWEVIQGMKLEYHKGNTY 347 + TDTM +E+ ++ FL+ W ++ + +E + N Y Sbjct: 195 QDTDTMREELDDLQIFLSTRWAILLNLHVEMFRVNKY 231 >At5g16190.1 68418.m01892 glycosyl transferase family 2 protein similar to cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 504 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 9/79 (11%) Frame = +2 Query: 326 IPQG-KHIYNFTCTLPPVLPSSFEGEHGYVRYTVKVTLDRP--------WKFDQETKMAF 478 + QG +H Y TCT + + F+ E Y+ TV + P WKF K Sbjct: 153 LKQGMRHSYVKTCTYIAIFDADFQPEPDYLERTVPFLIHNPELALVQARWKFVNAKKCLM 212 Query: 479 TVINALDLSLIHLTRNQST 535 T + + L+ H T Q + Sbjct: 213 TRMQEMSLN-YHFTAEQES 230 >At2g41790.1 68415.m05165 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain; similar to insulin-degrading enzyme (Insulysin, Insulinase, Insulin protease) [Mouse] SWISS-PROT:Q9JHR7 Length = 970 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/77 (22%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = +3 Query: 120 IEYVFDSPKKVRGIHVKIKGEA-----HTELYXSKQEENAQGKTESTDTMIQEMKNISRF 284 ++++ S K G H+ + E+ ++LY E+ T D +++ KN+ Sbjct: 810 VQFIIQSSVKGPG-HIDSRVESLLKNFESKLYEMSNEDFKSNVTALIDMKLEKHKNLKEE 868 Query: 285 LTIYWEVIQGMKLEYHK 335 YW IQ L++++ Sbjct: 869 SRFYWREIQSGTLKFNR 885 >At1g80540.1 68414.m09441 expressed protein ; expression supported by MPSS Length = 481 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -1 Query: 435 NVTLTVYLT*PCSPSKDEGRTGGNVQVKLYMC 340 NVT + Y+ PC+PS + RT N+ ++L +C Sbjct: 88 NVTNSHYIAPPCNPSLNYLRTSNNL-IRLLIC 118 >At5g13520.1 68418.m01561 peptidase M1 family protein similar to SP|P09960 Leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4 hydrolase) {Homo sapiens}; contains Pfam profile PF01433: Peptidase family M1 Length = 616 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 213 PVCXHTIRYELHP*F*HVCLELFLDYQKHIRSFHSLFVLHNMYS 82 P+ H+ HP HV L L+LD+ I +L L + +S Sbjct: 3 PIDPHSFTDSSHPLTTHVALSLYLDFNTSIIHGSALLTLSSAFS 46 >At5g08030.1 68418.m00934 glycerophosphoryl diester phosphodiesterase family protein similar to glycerophosphodiester phosphodiesterase [Borrelia hermsii] GI:1399038; contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 372 Score = 27.9 bits (59), Expect = 6.3 Identities = 21/78 (26%), Positives = 40/78 (51%) Frame = +3 Query: 36 KDMGLKEANIYLDNQWNTYYAGQTVNGRIEYVFDSPKKVRGIHVKIKGEAHTELYXSKQE 215 K +G K+ + D Q+N + T + I D+P+ V GI+ +IK ++ ++Q Sbjct: 135 KTLGAKQRYPFRDQQYNGKFPIITFDEYISIALDAPRVV-GIYPEIK----NPVFMNQQV 189 Query: 216 ENAQGKTESTDTMIQEMK 269 + A GK + D ++ +K Sbjct: 190 KWADGK-KFEDKFVETLK 206 >At4g39180.1 68417.m05548 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative phosphatidylinositol-phosphatidylcholine transfer protein SEC14, Yarrowia lipolytica, PIR2:S43745; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 554 Score = 27.9 bits (59), Expect = 6.3 Identities = 24/106 (22%), Positives = 47/106 (44%), Gaps = 4/106 (3%) Frame = +3 Query: 48 LKEANIYLDNQWNTYYAGQTVNGRIEYVFDSPKKVRGIHVKIKG-EAHTELYXSKQE--E 218 L EAN+Y Y G TV + EY+ KK+ + K K EA Y +++ + Sbjct: 449 LTEANVYSREGSAVYQDGVTVMSKQEYI-AMVKKITDLEEKCKSMEAQAAFYMEREKTLD 507 Query: 219 NAQGKTESTDTMIQEM-KNISRFLTIYWEVIQGMKLEYHKGNTYII 353 A + + + + E K + +T E++ ++ + K +++ Sbjct: 508 AALRRIDQLELQLSETNKALDETMTRQHEIMAFIEKKKKKKRKFLL 553 >At1g03103.1 68414.m00286 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam profile PF00234:Protease inhibitor/seed storage/LTP family; low similarity to SP:Q42978 Nonspecific lipid-transfer protein 2 precursor (LTP 2) {Oryza sativa} Length = 171 Score = 27.9 bits (59), Expect = 6.3 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -1 Query: 456 SNFHGLS-NVTLTVYLT*PCS---PSKDEGRTGGNVQVKLYMCFPCGIPISFP 310 S+F+G N TL + L C+ PS TGGNV L P G P S P Sbjct: 74 SSFYGFKFNRTLALNLPTACNVQTPSPSLCNTGGNVPTTLPANTPVGSPRSAP 126 >At3g42410.1 68416.m04385 replication protein-related weak similarity to Replication Protein A 70 kDa DNA-binding subunit (RP-A) (RF-A) (Replication factor-A protein 1) (Single-stranded DNA-binding protein) (DMRPA1) (GI:2498844)(SP:Q24492) [Drosophila melanogaster] Length = 474 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +3 Query: 81 WNTYYAGQTVNGRIEYVFDS--PKKVR 155 WN Y + V+G+I+Y F P+K R Sbjct: 251 WNAYGDDEVVDGKIDYTFSDVHPRKTR 277 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,837,462 Number of Sequences: 28952 Number of extensions: 332711 Number of successful extensions: 841 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -