BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1652 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 31 0.027 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 9.4 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.4 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 31.5 bits (68), Expect = 0.027 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 2/76 (2%) Frame = +1 Query: 463 RWRSTPTPRCKRVECAVVVLPLG*FAQAIRLHNNETPYRTPDIAHVTRD--HRTHHMRYT 636 R+R T K EC + L + IR H E P++ P + + D T HMR Sbjct: 203 RYRHTHERPHKCTECDYASVELSKLKRHIRTHTGEKPFQCPHCTYASPDKFKLTRHMRIH 262 Query: 637 FANQRFPNNSIFFRVT 684 + + + F R T Sbjct: 263 TGEKPYSCDVCFARFT 278 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.4 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +3 Query: 126 IEYRQRNGEQKQNYL 170 +E+R+RNG Q+ ++L Sbjct: 257 VEHRERNGVQRNDFL 271 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 308 YNFRRVQIQNGYSRAP 355 Y+FRR+ Q GY +P Sbjct: 1475 YSFRRIAQQGGYGGSP 1490 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,833 Number of Sequences: 2352 Number of extensions: 10977 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -