BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1649 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch... 28 1.2 SPBC6B1.09c |nbs1||Mre11 complex subunit Nbs1|Schizosaccharomyce... 27 3.5 SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo... 25 8.2 >SPCC417.08 |tef3||translation elongation factor eEF3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1047 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 303 VNCSNMEQKFPSPLFVFGEKVRTRAI 380 + S ME KFP P F+ G K + RAI Sbjct: 647 LGASEMEFKFPEPGFLEGVKTKQRAI 672 >SPBC6B1.09c |nbs1||Mre11 complex subunit Nbs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 613 Score = 26.6 bits (56), Expect = 3.5 Identities = 10/48 (20%), Positives = 26/48 (54%) Frame = -1 Query: 684 RWHVDVSFYVVVTGVRHTNSRRHSTTFRSAGENCSAASGWAAARSTIL 541 +W +++ + TG+R +++ H R AG + + + +A + T++ Sbjct: 128 QWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLKKTVI 175 >SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 1811 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 112 IRTTVGFNEECCVPQRWMPNGPDPTLDLVIALMCMGLYPNVCLHI 246 +RT + + V R + P P +D V +C+ L NV H+ Sbjct: 418 LRTYMNILSDINVKIRSPTSTPTPLIDAVKQYICLALAKNVVSHV 462 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,820,873 Number of Sequences: 5004 Number of extensions: 52898 Number of successful extensions: 130 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -