BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1649 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 26 0.31 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 26 0.31 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.2 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 22 6.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 8.8 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 8.8 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 26.2 bits (55), Expect = 0.31 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 94 SAVRPSIRTTVGFNEEC 144 S V+PS+ +T GF++EC Sbjct: 75 SQVQPSVASTTGFSKEC 91 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 26.2 bits (55), Expect = 0.31 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 94 SAVRPSIRTTVGFNEEC 144 S V+PS+ +T GF++EC Sbjct: 75 SQVQPSVASTTGFSKEC 91 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.2 bits (50), Expect = 1.2 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +3 Query: 87 SVVCCTPFHSHHRRLQRRMLCSTTLDAERTGPNFGLGHSPHVHGPVP 227 S + TP H H ST L +GH+PH H P Sbjct: 424 SHIHATPHHHHSHAATPHHQHSTPLAHSSYPAAIQIGHTPHHHPHPP 470 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 589 LAGRAKGGRMSAGVCV 636 LA R KGG GVC+ Sbjct: 86 LAQRRKGGSCRNGVCI 101 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 62 SIDKYPHDRNRLQRRT 15 S+DK+P+ R R Q RT Sbjct: 386 SVDKHPNRRARGQLRT 401 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +3 Query: 432 CNKVEWVDNVVRLDNWLNFQ 491 C ++ W NV L W N Q Sbjct: 332 CVQIPWDKNVEALAKWANGQ 351 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,199 Number of Sequences: 438 Number of extensions: 3938 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -