BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1648 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0423 - 3092863-3094959 28 6.2 01_05_0110 + 18225431-18226992,18227158-18228132,18228343-182284... 28 6.2 >02_01_0423 - 3092863-3094959 Length = 698 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -2 Query: 252 IKNDIK-VTKKANEYTLKMLNNRLSNYTPNNSGPTKTTELIQF*FDVSRSSLES 94 ++ IK +TK N T+ + NRLS PN+ G K E + ++ L S Sbjct: 250 LEGSIKGITKLKNLVTIDLGQNRLSGSIPNSIGQLKRLEKLHLAYNSMSGELPS 303 >01_05_0110 + 18225431-18226992,18227158-18228132,18228343-18228437, 18228556-18228842 Length = 972 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 237 KVTKKANEYTLKMLNNRLSNYTPNNSGPTKTTELIQF 127 ++ K N + + NN+LS PN G K+ E++ F Sbjct: 529 EIGKLVNLNLIDLRNNQLSGKVPNQIGQLKSLEILDF 565 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,477,852 Number of Sequences: 37544 Number of extensions: 256576 Number of successful extensions: 385 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -