BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1648 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 27 0.43 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 3.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 3.0 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 27.5 bits (58), Expect = 0.43 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 201 MLNNRLSNYTPNNSGPTKTTELIQF*FDVSRSSLESCLRY 82 MLN L N T G K + +F FD +R+ LE C Y Sbjct: 866 MLNYFLLNLTGPKKGNFKVKDKREFEFDPARTVLEICRIY 905 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 207 LKMLNNRLSNYTPNNS 160 +K+ +N LSNY PN+S Sbjct: 1940 VKLSSNELSNYLPNDS 1955 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -2 Query: 207 LKMLNNRLSNYTPNNS 160 +K+ +N LSNY PN+S Sbjct: 1941 VKLSSNELSNYLPNDS 1956 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,657 Number of Sequences: 2352 Number of extensions: 11743 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -