BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1646 (691 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 38 3e-04 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 9.1 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 37.9 bits (84), Expect = 3e-04 Identities = 19/75 (25%), Positives = 38/75 (50%) Frame = +3 Query: 255 GHCKSLAPEYAKAATKLAEEESPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDY 434 G CK +AP+ + K A++ I + KVD + ++LA Y + PT F + + Sbjct: 33 GPCKVIAPKLEEFQNKYADK---IVVVKVDVDECEELAAQYNIASMPTFLFIKRKEVVGQ 89 Query: 435 SGGRQADDIISWLKK 479 G A+ + +++++ Sbjct: 90 FSGANAEKLENFIQQ 104 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 201 NCNYNHGVHFS*ILCSMVGHC 263 NCN++HG H S +C + C Sbjct: 368 NCNHHHGFHPS-TVCKIPPGC 387 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,250 Number of Sequences: 2352 Number of extensions: 12544 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -