BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1644 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.20 |grx1||glutaredoxin Grx1|Schizosaccharomyces pombe|c... 28 1.2 SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyce... 27 3.8 SPBC1709.19c |||NifU-like protein|Schizosaccharomyces pombe|chr ... 26 6.6 SPAC21E11.06 |tif224||translation initiation factor eIF2B delta ... 25 8.7 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 8.7 >SPAC4F10.20 |grx1||glutaredoxin Grx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +3 Query: 330 VYNMRYCPYAQRTILALNAKQIDYEVVNIDLIDKPE----WLTTKSAFAKVPAIEI 485 V+ YCPY T + K+I +V IDL++ + +L K+ VP I I Sbjct: 19 VFAKSYCPYCHATEKVIADKKIKAQVYQIDLMNNGDEIQSYLLKKTGQRTVPNIFI 74 >SPBC1105.10 |rav1||RAVE complex subunit Rav1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1297 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 85 CVDM**NCNKNMITSTVSLAMHLIYSSFQGVRVISQVLEYVLP 213 C D C +N+ + ++++AM +Y G + + EYVLP Sbjct: 1068 CYDAAKVCIRNLKSISLAIAMTRVYEGDDGPTLKRLINEYVLP 1110 >SPBC1709.19c |||NifU-like protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 260 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +2 Query: 554 PLLPQDPLKKALDKIIVEASAPIQSLFIKILKFS 655 P+L ++PLK A D I+E+ + I ++ ++++ S Sbjct: 135 PVLSEEPLKGASDTQILESDSQIVAMIKELIETS 168 >SPAC21E11.06 |tif224||translation initiation factor eIF2B delta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 141 GHAPNIFVVSRCSSYQSSIRIRL 209 GH N+ V++ C SY+ + RI+L Sbjct: 365 GHESNVPVIACCESYKFTERIQL 387 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 8.7 Identities = 10/38 (26%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 593 CPMLSSKDLAAVKAF--SDRPHLNIQLSLSFVNGHIFC 486 C + ++ A+KA D L ++ + + NGH++C Sbjct: 10 CKEIQENEIEALKAIFMDDFEELKVRNAWNVTNGHVYC 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,916,976 Number of Sequences: 5004 Number of extensions: 57786 Number of successful extensions: 134 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -