BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1643 (719 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) 28 8.8 SB_17518| Best HMM Match : F5_F8_type_C (HMM E-Value=1e-29) 28 8.8 SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 28 8.8 >SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2484 Score = 27.9 bits (59), Expect = 8.8 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 228 YVFYFFIIFPSLQY*SYVLISNMSHLI*YYKFSYLAIVK---I*QCNIEFV 371 YVF FF PSLQY +++ + +K SY+ V + Q N+ +V Sbjct: 1809 YVFLFFPDSPSLQYLEMLVMLKAVRIFQLFKLSYVLQVTLSYVLQVNLSYV 1859 >SB_18643| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1885 Score = 27.9 bits (59), Expect = 8.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 168 PKRIRSRELSARLFQISTQYYVFYFFIIFPSLQ 266 PKR ARL ++S Q + F FF +F +L+ Sbjct: 1333 PKRDEGYARKARLHKVSEQMFAFGFFRLFRALR 1365 >SB_17518| Best HMM Match : F5_F8_type_C (HMM E-Value=1e-29) Length = 213 Score = 27.9 bits (59), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 13 PSMCQAAALSCCGFSDDKSQQKQC 84 P +CQ L C G D++SQQ C Sbjct: 17 PVLCQNTYLFCVGIPDEQSQQCVC 40 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 27.9 bits (59), Expect = 8.8 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +2 Query: 164 YSKTHTLP*IERTIISNQYSVLRVLFF--YYIPVSSILVLC 280 YSK L I+ T+IS++ +RV+F YY+ +++V C Sbjct: 18 YSKMALLIRIDDTVISDEEVKIRVVFLSAYYLYFRAVIVRC 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,160,648 Number of Sequences: 59808 Number of extensions: 393675 Number of successful extensions: 711 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1913853903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -