BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1643 (719 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical pr... 29 2.5 Z68004-1|CAA91981.1| 435|Caenorhabditis elegans Hypothetical pr... 29 4.4 >Z74034-3|CAF31476.1| 322|Caenorhabditis elegans Hypothetical protein F43A11.6 protein. Length = 322 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -3 Query: 207 IIVRSIHGSVCVLEYIQCFGY-GVESTCFSISICHCASYVSEALFLLGFV 61 +IV I GSVC L + F Y E T F++ IC S + + L GF+ Sbjct: 26 MIVNGIFGSVCNLSIVYIFMYVPKEKTSFNL-ICVFRSLGNTIILLWGFI 74 >Z68004-1|CAA91981.1| 435|Caenorhabditis elegans Hypothetical protein F47B10.1 protein. Length = 435 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 298 AILFDITSFLI*LSLKFNNAILNLFRCRLEGLIGCMINQCDL 423 A LFD+ L+ A NL RL+G IGCM+N L Sbjct: 257 AKLFDLKDKKQEDELEIRAAAANLNYIRLDGTIGCMVNGAGL 298 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,227,200 Number of Sequences: 27780 Number of extensions: 304203 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1687292480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -