BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1641 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 4.1 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 4.1 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 4.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 9.4 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.4 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 482 NQLLVLVLKNKIAKAIQN*FMYN 414 N+ +LVL NK+ K + N F ++ Sbjct: 374 NREYILVLSNKMQKMVNNDFNFD 396 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 482 NQLLVLVLKNKIAKAIQN*FMYN 414 N+ +LVL NK+ K + N F ++ Sbjct: 374 NREYILVLSNKMQKMVNNDFNFD 396 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 482 NQLLVLVLKNKIAKAIQN*FMYN 414 N+ +LVL NK+ K + N F ++ Sbjct: 374 NREYILVLSNKMQKMVNNDFNFD 396 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 Query: 236 HTNNSQWLFRV 204 +TNNS+W F+V Sbjct: 211 YTNNSKWDFKV 221 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -1 Query: 618 TSAIPGQSRAAAYRQILSNNE*IYAHVDSMPPLWA 514 T+AIP A YR + + ++ P WA Sbjct: 270 TAAIPTSENPADYRYFCPDGSKVPIDANTKPCTWA 304 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -1 Query: 618 TSAIPGQSRAAAYRQILSNNE*IYAHVDSMPPLWA 514 T+AIP A YR + + ++ P WA Sbjct: 270 TAAIPTSENPADYRYFCPDGSKVPIDANTKPCTWA 304 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -1 Query: 618 TSAIPGQSRAAAYRQILSNNE*IYAHVDSMPPLWA 514 T+AIP A YR + + ++ P WA Sbjct: 270 TAAIPTSENPADYRYFCPDGSKVPIDANTKPCTWA 304 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 82 ASLDSGVPQSHLLPTRTL 29 A++ PQ H+LP +TL Sbjct: 1003 ANIKQQSPQQHVLPGKTL 1020 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,173 Number of Sequences: 438 Number of extensions: 4922 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -